KEGG   Cyanobium gracile: Cyagr_0014Help
Entry
Cyagr_0014        CDS       T02359                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase, large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cgc  Cyanobium gracile
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cyagr_0014
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyagr_0014
Enzymes [BR:cgc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cyagr_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(13444..14856)
Genome map
AA seq 470 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLTDLDFYKGRCYRIEDVPGDKESFYAFIAYPLDLFEEGSVTNVLTSLVGNVFGFK
ALRHLRLEDIRFPMAFIKTCPGPPNGIHVERDRMNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDFTKDDENINSQPFQRWQNRFEFVAEAVQLAQEETGEKKGHYLNCTAATPE
EMYERAEFAKELGQPIIMHDYITGGFTANTGLSKWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGFIDQLRESFIPEDRTRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALVAIFGDDSVLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKEGRDILTEAAKHSPELAIALETWKEIKFEFDTVDKLDVG
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagtacgacgccggggtcaaggagtaccgcgacacttactggactcccgat
tacgtccccctcgacaccgacctgctggcctgcttcaagtgcaccggccaggaaggtgtg
cccaaggaagaggtggctgccgccgtggccgccgagtcctccaccggcacctggtccact
gtgtggtccgagctcctcaccgatctcgacttctacaagggccgctgctaccgcatcgaa
gacgtccctggtgacaaggagtccttctacgcgttcatcgcctaccccctcgacctgttt
gaggaaggctccgtgaccaacgtgctcacctccctggtgggcaacgtgttcggcttcaag
gccctgcgccacctgcgcctggaagacatccgcttcccgatggccttcatcaagacctgc
cccggcccgccgaacggcatccacgtcgaacgcgaccggatgaacaagtacggccgtccc
ctgctgggttgcaccatcaagccgaagctgggcctgtccggcaagaactacggccgggtg
gtctacgaatgcctccgcggcggtctcgacttcaccaaggacgacgagaacatcaactcc
cagcccttccagcgctggcagaaccgttttgagttcgtggccgaagccgtccagcttgcc
caggaagaaaccggcgagaagaaggggcactacctcaactgcaccgccgccactcccgag
gagatgtacgagcgggccgagttcgccaaggaactcgggcagccgatcatcatgcacgac
tacatcaccggtggcttcaccgccaacaccggtctgtcgaagtggtgccgcaagaacggc
atgctgctccacatccaccgcgccatgcacgcggtgatcgaccgccatcccaagcacggc
atccacttccgggtgctggccaagtgcctgcgcctctccggcggcgaccagctgcacacc
ggcaccgtggtgggcaagctcgagggtgaccgtcagaccaccctgggcttcatcgaccag
ctgcgcgaatccttcattcccgaagaccgcacccgcggcaacttcttcgatcaggactgg
ggttcgatgcccggcgtcttcgccgtggcctccggcggcatccacgtgtggcacatgccc
gccctggtcgccatcttcggtgacgactccgtgctccagttcggtggtggcacccacggt
cacccctggggttcggccgccggcgccgccgccaaccgggtggccctcgaagcctgcgtc
aaggcccgcaacgccggccgcgagatcgagaaggaaggccgcgacatcctcacggaagcc
gccaagcacagccccgagctggccatcgccctcgagacctggaaggaaatcaagttcgag
ttcgacaccgtcgacaagctcgacgtcggctga

DBGET integrated database retrieval system