KEGG   Cupriavidus gilardii: CR3_3314Help
Entry
CR3_3314          CDS       T04050                                 

Definition
(GenBank) peptide synthetase
Organism
cgd  Cupriavidus gilardii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(471035..480697)
Genome map
AA seq 3220 aa AA seqDB search
MQGETLLDYLIHHATGRADAMALTVLDEDHPEGTPYCYRDLLARAAAYATRLSEVARPGE
RAMIVLDTGIDYVSAFLGCLLARVIAVPAFPPESMRPQHLARLNAIAADAQPAVVVVDDG
LAGDWASGRSASLQAHVVTVSSVRPASPGPTVADARAWAAAIRPDAIAFLQYTSGSTATP
KGVMVTHANIVANEAAIASQFGTTADDVMVSWLPLYHDMGLIGGLLHPLYGGMPLVLMSP
TYFLQRPRRWLEAMDRFRGTVSGGPDFAYRLCVERVRAAQVPTLSLRSWRVAFCGAEPIR
AETLERFASHFAAAGLDVRALYPCYGLAEATLLATGGRPGEGATLIGFDEAALASGHAVA
SIDGDGTRLVACGDAAPGHRVDIRCVEHGQPLPDGQIGEICISGPSVTAGYWQQPEATAR
TFPDHGDAASRYLRTGDLGFLHDGRLYVAGRLKDLIIVRGHNLYPQDIEIAVEAAVEVVR
KGRVAAFPFQSADGRIETIGIAAEIARSIQKFGSPEAVETAIREAVAHCCGEPPGLVLLL
QPGELPKTTSGKLQRSRCLPAWRSGELALWAAFESGRQLASVPSLDGAAAPVVSANANAD
AVALQGTEATLAELWQEVLGVHPASADDNFFALGGNSVRATQLVSRIRERLHRGYALAHL
FADGSLRANAAVIDRLLARDEGETPSEDMAISRRPDSELAPLSPVQRGLWVLWSMQPDSG
AYNVSGVLKLRGRFDRIALQRAVDALVARHEALRTRFELDQHEEPRQRALPARPCPIAVV
DLREPGPDAAAKAQAKARELSAEPFDLLAAAPVRIAQLLVANDQEWLSITVHHIVSDGWS
MNVAIDEFCRLYDGFAADRPVELPPLAIRYADYAAWHADRLGAGERDRQLGYWKGRLGDQ
PAVLELPWDRPRPVVQSHRGGAVPFMLDGPLATSLRGIALAAQTTMFAVLLAAFQTLLYR
YTGQRDVRVGVPVANRGSVETEGLIGCFVNTIVVRTDIDGSMPWDALLRRLHQTVRESQQ
YQDLPFEQLVEALQPERSLAHNPLFQVKFNLALPIAVPKQLAGYVVTAEQIEGDVTRFDI
ALDLVESEDGIAGRLSYATDLFDHDTIERMRDHYVRVLEQIASTPTLRVGELKLGNEDGR
LIGESVTSAPTDVLAAWRRNLDADSSAIALRYEEQTLTRGETDRLANGIAAALVERGVGR
ETRVGLCVERSPAFVTGLLGILKAGAVCVPLDPAQPAERLRQLLDDAAARVVVGSVPGFD
CLDPASVAPVDAAPFVSLLPGQAAYLIYTSGSTGTPKGVLVSHDALAHYVSGALHRLELP
ADASMAMVSTTAADLGHTVLFGALCSGRTLHLISRERGFDPDRFAEYMARHRVGVLKIVP
SHLRGLLQARQPADVLPEQALILGGEATSAELARTVRDLKPHCRLFNHYGPTETTVGVLT
HEAVTLPERQLPTGTPLPGSRVYVLDADLNPVPAGIVGELYIAGPQLARGYLGRPGLTAE
RFVPDPFTDGARMYRTGDRVKQDADGRIEYLGRQDEQVKIRGYRVELGEIAHLLRSQPGV
KDAAVIVHEERFVAYCVLDAIDATTIKDRLKAQLPDHMVPAQLIALDRLPVTPNGKLDRR
ALPAPVWETQGYVAPRNEIEALLAQVWQEVLGVEQVGIHDNFFELGGDSILSLQSVSRAR
RLGLRFTPKDLFLHQTVQALAQVAKRDETHRRVDDRPAGEVPLLPIQRAFFETPMPNRHH
WNQSVLLRPAEPLDPNALRSALKALVAHHDALRLRYRQQDGQWQQHYAEPPDGDLLWQQQ
IDDAGSIAAHCDRAQRSLDLAQGPLLRALHLQLPDGSERLLLVVHHLVVDGVSWRILLED
LQQAYRTAQQRQPIALAPKTAPYKAWAQALVQYANSDELTRQVDYWRGQHGPEVPCDHAV
SDDRIAEAATLTLRLSPAQTQRLLKQAPAAYRTQINDLLLSALAQAVGQWAGIDRAAVLL
EGHGREALRATPDIARTVGWFTTMFPVVLPAVDDTAASIKSVKETLRAVPDQGIGYGLLR
HLGPQALRDQLAPRALPRITFNYLGQFDQNVGGDALFDFADESSGASRDPEAPLGNWITI
NGQVTGGALSLGITFSTARYRQETIASLLRAYRQALESTIDHCLSVPSGALTPSDVPLAG
LTQDQLDRLVGRQIEDLYPLTPMQHGMLFHSLYAPEAGLYVNQLAITLDGLDADRFGAAW
DDTVARHEILRTGFVWIEGQAMQAVYRQVPSPVRIDAQRQWSDADFDEVALSERKQAFAL
DTPPLMRVRLLRLGANRYRMIWTSHHLLLDGWSTARLIGEVLQRYHGQPVEAPASRYRDH
IAWLQTHDVAASESFWRERLQALDEPTRLASALPAPDAGPGHATCRTTLDADALARIQRS
AASQHLTLNTLLQAAWVIVLQRYTGRRAVAFGATVAGRPAALSGAEAMLGLFINTLPVIQ
APAPDQSVADWLQALQAENLALREHEHVPLYEIQRWAGQGGQALFDSILVFENYPVDAAL
RQREQNGLKLGEVSHAATTNYPLTLVVSAGATLDIVCSYQREAFSHAAVEQLQRQYVGVL
DQLAAASATPPATRIGDLNLIDTDCHESSPGRDPADRRFSAADPVHVAIARQATRRPDAI
AIRCGGHAVSYGELDAAATRLAYALHAAGARPEAVVGVVLDRSPDLIVRLLATLKAGAAY
LPLDPELPHARIAQLLQDAGVKLVLTSQALVGRIDTTLPLVVMEDIGDPAPIQLPAVDPR
QLAYLIYTSGSTGTPKGVAVEHGPLAMHCHATAEQYGMGPDDRELHFLSFNFDGAHERWL
VPLIAGAQLVLRDDTLWSAEQTLEVIAREGVTNAGFPPAYLLRLAEAATEPVPLRLLSFG
GEAMSREAFARIKQKFQAGTLINGYGPTEAVVTPLAWVSQHDTDCPSAYVPIGGPVGDRT
AYVLDADLNPVPVGVAGELYIGGLGLARGYVGNPGLTAERFVPDPFTTSARMYRTGDLVR
RCRDGTIEYVGRLDHQVKIRGYRIELGEIEARLRAHATVREAVVVAHDGPSGKQLIAYVV
PDQGEGEVAAPLKAYLESVLPPYMVPAQIVPLNQLPVTSNGKLDRRALPEPVWETQAYVA
PRNDVEAMLATIWQEVLGVEQVGVHDDFFALGGHSLLLTQLVSRLHREFDNTLTLRQAMS
LPTVADLADYIAQQQATGATVNVASQLQTIDDLMADLETS
NT seq 9663 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcgagacgctgctcgactatttgatccatcacgcgacaggccgcgccgatgcg
atggcgctgacggtgctggacgaggaccatcccgaaggcacgccctactgctatcgcgac
ctgctcgcgcgcgcggcggcctatgccacgcgactgagcgaagtggcccggcccggggag
cgcgcgatgatcgtgctcgataccggtatcgattacgtcagcgcgtttctgggctgcctg
ctggcgcgcgtcatcgcggtgccggccttcccgccggagtcgatgcggccgcagcatctg
gcacggctcaacgccatcgccgccgacgcgcagcctgctgtggtggtggtcgacgacgga
cttgccggcgactgggccagcggccggtccgccagcctgcaagcccacgtcgtcaccgta
tcgtcagtccggccagcgtcgcctggacccaccgtcgcggacgcgagggcctgggccgcg
gccatccgtcccgacgccattgccttcctgcagtacacctccggctcgaccgcgaccccg
aagggcgtgatggtgacgcacgccaatatcgtcgccaacgaagcggccatcgccagccag
ttcggcaccacggccgacgacgtgatggtcagctggctgccgctctatcacgacatgggc
ctgatcggcggactgctgcatccgctttatggcggcatgccgctggtgctgatgtcgcca
acctatttcctgcaacggccgcgccgctggctggaggcgatggaccggttccgcggcacc
gtcagcggcggccccgacttcgcctatcggctgtgcgtggagcgcgtacgcgcggcacaa
gtgccgaccctgtcgctgcgcagctggcgcgtcgccttctgcggcgccgagccgattcgc
gccgaaacactggaacgatttgccagccacttcgccgccgccggcctcgacgttcgtgca
ctctatccctgctatggcttggccgaggcaacgctgcttgctaccggggggcgtcccggg
gaaggcgccacgctgatcggattcgacgaggccgcgctggcatccggacacgcggttgca
tcgatcgatggcgacggtacgcgactggtcgcctgcggcgatgccgccccgggtcatcgc
gtcgacatacgctgcgtcgagcatggccagccgcttccagacgggcagatcggggagatc
tgcatcagcgggccaagcgtgacggcgggctactggcagcagcccgaggccaccgccagg
acgttccctgatcacggcgacgccgcatcgcgctatctgcgcaccggcgacctcggcttc
ctgcacgacggcaggctctatgtcgccggacgcttgaaggacctgatcattgttcgcgga
cacaacttgtatccgcaggacatcgagatcgcggtcgaagcggcggtcgaggtcgtgcgc
aaggggcgcgtcgcggccttcccgttccaatccgccgacggtcggatcgaaacgatcggc
atcgccgccgagattgcgcgcagcatccagaagttcggctcgcccgaagcggtggaaacc
gccatccgcgaggcggtggcgcactgctgcggcgagccgccgggtctggtgctgctgctg
cagcccggcgagttgccgaagaccaccagcggcaagctgcagcgctcgcgctgcctgccg
gcctggcgcagtggcgaactggcactgtgggccgcattcgaatcggggcggcagctcgca
tcggtcccttcgctcgacggcgcggcggcgccggtcgtgagcgccaatgccaacgccgat
gccgtggcgctgcagggcaccgaggcgactctggcggagctatggcaggaagtcctgggc
gtccaccccgcctcggccgatgacaacttctttgccctgggcggcaactcggtgcgcgcg
acccagctggtgtcgagaatccgggagcggctgcatcgtggctacgcgctggcgcatctg
tttgccgatgggtcgctgcgggccaacgcggcggtcatcgaccggttgctggcgcgcgac
gagggagaaacgccgtccgaggacatggccatctcgcgccggcccgacagcgagctcgcc
ccactgtctccggtgcagcgcggcctgtgggtgctgtggtcgatgcagcctgacagcggc
gcctacaacgtctcgggcgtgctgaagctgcgcggccgtttcgaccggatcgcgctgcaa
cgcgcagtggacgcgctggtcgcccggcacgaggccctgcgcacccgcttcgaactggac
cagcatgaggaaccgcggcagcgcgcgctgccggcccgtccctgcccgatcgcggtagtg
gacttgcgcgagcctggtcccgacgccgccgccaaggcgcaggcaaaggcgcgagagctc
agcgccgagccgttcgacctgctagccgcggcgcccgtgcgcatcgcgcaattgcttgtt
gccaacgaccaggaatggctgtcgatcacggtccaccatatcgtgtcggatggatggtcg
atgaatgtggcgatcgacgagttttgccggctctatgacggcttcgcggccgatcgcccg
gtcgagttgccgccactggcgatccgctacgcggactatgccgcctggcatgcggaccgt
ctcggtgccggcgagcgcgaccgccaactcggctactggaagggccgccttggcgaccag
cctgctgtactggaactcccctgggatcgcccgcggcccgtggtgcagagtcatcgcggc
ggcgcggtgcccttcatgctggacgggccgttggcgacaagcttgcgtggcatcgcgctc
gctgcacagacgacgatgttcgcggtgctgttggccgccttccagacgctgctgtaccgc
tacacggggcagcgcgatgtccgggtcggcgtgccggtcgccaatcgtggcagcgtcgag
acggaaggcctgatcggatgcttcgtcaatacgatcgtcgtgcgcacggacatcgatggc
agcatgccgtgggatgccctgctgcgccggctgcatcagacggtgcgcgagtcgcagcaa
taccaggacctgcccttcgaacagttggtcgaggcgctgcagccggaacgcagcctcgcc
cataacccgctgttccaggtcaaattcaacctggcgctgccgattgcggtccccaagcaa
ttggctggctacgtcgtcacggccgaacagatcgagggcgatgtcacgcgcttcgatatc
gcgctggatctggtggaaagcgaggacggcattgcgggccggcttagctacgccaccgat
ctgttcgatcacgacacgatcgagcggatgcgcgaccactacgtccgcgtcctcgaacag
atcgcgtcgacaccgacgcttcgcgttggtgagttgaagttgggcaatgaggacgggcgg
ctcattggcgagtccgtgacgtcggcgccgaccgatgtgctggcggcatggcggcgcaac
cttgacgcggattcttctgccattgcgttgcgatacgaggaacagacgctgactcgcggc
gagacagatcggttggccaatgggattgcagcggcgctggtcgagcgcggtgttgggcgc
gagacgcgggttggactctgcgtcgagcgttcgccggcgttcgtgaccggcctgcttggc
atcctgaaggccggcgcggtttgcgtaccgctcgatccggcacagccggccgaacgcttg
cggcagttgctggacgatgccgcggctcgcgtggtggttggctccgtgccgggcttcgat
tgcctcgatccggcctccgtggcaccagtggacgcggcccctttcgtctcgttgcttcca
ggtcaggccgcttacctgatctacacctcgggctccactggcaccccgaagggcgtgctg
gtcagccacgatgcgctcgcgcattacgtctccggcgcgctgcaccggctcgagctaccg
gccgatgcctcgatggcgatggtctcgaccaccgccgccgacctcggccataccgtgctg
ttcggcgccctctgcagcggccgcaccttgcatctgatctcgcgcgagcgcggcttcgat
cccgatcgctttgcggagtacatggcgcggcaccgcgttggcgtactgaagatcgttccc
agccatctacgcggattgctccaagctcgccaacccgccgatgtcttgcccgagcaggcg
ctgatcctcggcggtgaggccacctctgccgaactggctcgcacagtccgcgacctgaag
ccgcactgccggttgttcaaccactacgggcccacggagacgacggtcggcgtactgacg
cacgaggccgtaaccttgcccgaacggcaactgcccaccggcacgccgctgcccggctcc
cgcgtctatgtgctcgacgctgacctgaacccagtgccggccggcatcgtcggcgagctc
tatatcgccggaccgcagctggctcgcggctatctgggacggccagggctgaccgccgag
cgcttcgtgcccgatcccttcaccgacggggcacggatgtaccgcaccggcgaccgcgtc
aagcaggatgcggacggccggattgaataccttggtcgccaggacgaacaggtcaagatc
cgcggctaccgcgtcgaactcggcgagattgcccatctgctgcggtcccagccgggcgtc
aaggatgccgccgtgatcgttcatgaggagcggtttgtggcctactgcgtgctggacgcc
atcgacgccacaacgatcaaggaccggctcaaggcacagctgcccgatcacatggtcccg
gcccagctgatcgcgctcgaccggctgccggtcacgccgaatggcaagctcgatcgccgc
gcgctgcccgcgccggtctgggaaacgcaaggctacgtcgccccgcgcaacgagatcgag
gcgctgctggcgcaggtctggcaggaggtgcttggcgtcgaacaggtcggcatccacgac
aacttcttcgagctcggtggcgactcgatcctgtcgctccagtcggtcagccgcgcccgc
cgactgggcctgcgtttcacgcccaaggacctgttcctgcatcagaccgtgcaggcgctc
gcacaagtggccaagcgcgacgaaacccatcggcgcgtcgacgacaggcctgccggcgag
gtgccgctgctgccgatccagcgggcgttcttcgagacgccgatgccgaaccgccatcac
tggaatcaatcggtactgctgcgaccagcggagcctctggacccgaacgcgctgcgcagc
gcgctgaaggcgctggtcgcccatcacgacgcattgcggctgcgctaccgccagcaggac
gggcaatggcagcaacactacgccgagccccccgatggcgacttgctgtggcagcagcaa
attgacgacgccggttccatcgcagcgcactgcgaccgtgcccagcgcagcctggacctt
gcacaggggccattgctgcgcgctctgcatctgcaattgccggatggcagcgagcgcctg
ctgctcgtcgttcaccaccttgtcgtggacggcgtctcgtggcgcatcttgctggaagac
ctgcagcaggcataccggaccgcgcagcaacgccaaccgatcgctctcgcgcccaagacg
gcgccgtacaaggcctgggcacaggcgctggttcaatatgcgaactccgacgaactcacc
cggcaagtggactactggcgcggccagcacggcccagaggtcccttgcgaccacgccgtg
tcggacgaccgcatcgcggaggctgccacgctgaccctgcggctgtcgccggcgcagacg
cagcggctgctgaaacaagcgcccgcggcgtatcgcacgcagatcaacgacctgctgctg
agcgcgctggcgcaggcagtgggccagtgggcgggtatcgatcgcgctgccgtgctgctc
gaagggcatggccgggaagccttgcgcgcgacgccggatatcgcccgcaccgtcggctgg
ttcacgacgatgtttccggtggtactgccggcggtcgatgacaccgcggccagcatcaag
tcggtcaaggaaacgctgcgtgccgttcccgaccaaggcatcggctacggcttgctgcgc
catctggggccacaagctctccgtgaccaactcgcaccccgcgcactgccccgcatcacg
ttcaactatctgggtcagttcgaccagaacgtcggtggtgacgcgctattcgacttcgcc
gacgagtccagcggagccagccgcgatcctgaggccccgcttggcaactggatcacgatc
aatggacaggtgaccggcggcgcgctgtcgctgggcatcacgttcagcaccgcccgctac
cgccaggagaccatcgcttcgctgttgcgagcctatcggcaggcgttggagagcactatc
gaccattgccttagcgtgccgtccggtgcgctgacgccgtccgacgtaccgctcgccggt
ctgacccaggatcaactcgatcgcctcgtcggccgccagatcgaggacctgtatccgctg
acgccgatgcagcacggcatgctgttccactcgctctatgcgccggaagccgggctttac
gtcaaccagctcgccatcacgctcgacggcctcgacgccgatcgcttcggcgcggcctgg
gacgacacggtcgcacggcacgagatcctgcgtaccggctttgtctggatcgaggggcag
gccatgcaggcggtctatcggcaggtcccttcgccggttcgcatcgatgcacagcggcag
tggtcggacgccgacttcgatgaggtcgcgctcagcgaacggaaacaagccttcgcgctc
gatacccctccgctgatgcgcgtgcgcctgcttcgactcggcgcaaaccgctaccgcatg
atctggaccagccaccatctgctgctcgatggctggagcacggcccgattgatcggcgaa
gtcctgcagcgctaccatggccagccggtcgaggcgcctgcctcgcgctatcgcgaccac
atcgcctggctgcagacgcacgatgttgccgccagcgaatcgttctggcgcgagcggctg
caagcgctcgacgagccgacgcggctggcgtctgcccttcctgcgcctgacgccggcccc
ggtcatgcgacctgccgcaccacgctcgatgcagacgccctcgcccgtatccaacgcagt
gccgccagtcagcatctgacgctgaacacgctgctgcaagcggcctgggtcatcgtgctg
cagcgctataccggacggcgtgccgtcgccttcggcgccaccgtcgccggacggccggca
gccttgtccggtgctgaagcgatgctcggcctgttcatcaatacgctgccggtgatccag
gcgcctgcgcccgaccagtccgtcgccgactggctgcaggcgctgcaagcggagaacctg
gccctgcgcgagcacgaacacgtgccgctgtacgaaatccagcgctgggccggtcaaggc
ggccaggcgctgttcgactcgatcctggtgttcgagaactacccggtcgatgcggcgctg
cgccagcgcgagcagaacggcttgaagctcggcgaggtcagccatgccgcgaccaccaac
tatccgctgacgctggtggtctcagctggcgcgacgctcgatatcgtctgcagctatcag
cgcgaagcgttctcgcacgctgcggtcgagcaattgcagcggcaatacgttggcgtgctg
gatcaactggccgccgcttcggcgacgcctccggccacgcgtatcggcgacctgaatttg
atcgatacggactgtcacgagtcgtcgcctggccgggacccggcggaccggcgcttctcg
gctgccgacccggttcacgtggccatcgcgcgccaggccacccggcgcccggatgccatt
gcgattcgctgcggcggacacgccgtcagctatggcgagctcgatgccgccgccacgcgc
ctggcctacgcattgcacgcagccggcgcgcgcccggaggccgtcgtcggcgtcgtgctc
gaccgcagtcccgacctgatcgtgcggctgctcgccacgctgaaggccggcgccgcctat
ctgccgctggatccggaactgccgcacgcccgcatcgcgcaattgctgcaggacgctggc
gtcaagctggttctgacctcccaagctcttgtcgggcgcatcgataccaccctgccgctc
gtcgtcatggaggacattggcgatccggcaccgatccaactgcccgccgtcgatccgcgc
cagctcgcctacctgatctacacctcgggctccaccggcaccccgaagggcgtcgccgtc
gagcacggccccttggcgatgcactgccacgctaccgccgaacagtacggcatgggaccg
gacgatcgcgagctgcacttcctgtcgttcaacttcgacggcgcgcacgagcgctggctg
gtaccgctgatcgccggcgcccaactggtgctgcgcgacgacaccttgtggagcgccgag
cagaccttggaggtcatcgcccgcgaaggcgtgaccaacgccggcttcccgcccgcctac
ttgcttcggttggccgaagccgccaccgaaccggtgccgctgcgcctgctgtcctttggc
ggcgaagcgatgtcgcgcgaggccttcgcccggatcaagcagaaattccaggccggtacg
ctgatcaatggttatgggccgaccgaggccgtggtcaccccgctggcgtgggtcagtcaa
cacgacaccgactgcccgagcgcctatgtgccgatcggcgggccggtgggcgaccgcacg
gcttatgtgctcgacgccgacctgaaccccgtgccggtcggtgttgccggcgagctgtat
atcggcgggctgggccttgcgcgcggctatgtcggcaatccgggcctgaccgcggagcgc
tttgtccccgaccctttcaccaccagcgctcgcatgtaccgcaccggcgatctggtccgc
cgttgtcgcgacggcaccatcgaatacgtcggccgactcgaccatcaggtcaagatccgc
ggctatcgcatcgaactgggcgagatcgaggcgcggctgcgtgcgcacgcaaccgtgcgg
gaagcggtggtcgtcgcccacgatggcccgagcggcaagcagttgatcgcctatgtcgtg
ccggaccaaggcgagggagaggtcgcggcgccgctgaaggcatatctggaaagcgtcctg
ccgccctatatggtgcccgcgcagatcgtgccgctgaaccagttgccggtcacgtccaac
ggcaagctcgaccgccgcgcgctacccgagccggtatgggaaacacaagcctacgtggcg
ccgcgcaacgacgtcgaggcaatgctggcgacgatctggcaggaagtgctcggcgtcgag
caagtcggcgtacacgacgacttcttcgcgctcggcggccactccctgctgctgacgcaa
ctcgtatcccggctgcatcgcgagttcgacaacacgctgacgctgcgccaggcgatgtcg
ctgcccaccgtggccgacctggccgactacatcgcccagcaacaggcgaccggcgctacg
gtcaacgtcgccagccaattgcagaccatcgacgacctgatggccgacctcgagacttcc
taa

DBGET integrated database retrieval system