KEGG   Cricetulus griseus (Chinese hamster): 100757402Help
Entry
100757402         CDS       T02813                                 

Gene name
Pcsk1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100757402 (Pcsk1)
Peptidases [BR:cge01002]
 Serine Peptidases
  Family S8: subtilisin family
   100757402 (Pcsk1)
Chaperones and folding catalysts [BR:cge03110]
 Intramolecular chaperones
  Subtilisin family
   100757402 (Pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 720 aa AA seqDB search
MGGRKEGYRKYLLFRAWKEVSGCQENTIGSLENHYLFKHKNHPRRSRRSALHITKRLSDD
DRVIWAEQQYQKERSKRSVQRDSALNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQ
KGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDPTNENKHGTRCA
GEIAMQANNYKCGVGVAYNSKVGGIRMLDGIVTDAIEASSIGFNPGHVDIYSASWGPNDD
GKTVEGPGRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISS
ASQQGLSPWYAEKCSSTLATSYSSGDYTDQRITSADLHNDCTETHTGTSASAPLAAGIFA
LALEANPNLSWRDMQHLVVWTSEYDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLA
DPRTWRTVPEKKECVVKDNNFEPRALKANGEVTVEIPTRACEGQENAIKSLEHVQFEATI
EYSRRGDLHVTLTSAAGTSTVLLAERERDTSPNGFKNWDFMSVHTWGENPVGTWTLKITD
LSGRMQNEGRIVNWKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKMVNVMEEQPTQ
KSLNDSLLVPQSSSSSSVEGRRDKLAQGAPSEAVLWLLQSAFSKNPPSKQSPKKSPGAKL
SIPYESFYEALEKLNKPSQLKDSEDSLYSDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcaggaaagaaggctaccgaaaatatctacttttcagggcttggaaagaagtg
tcaggttgccaggagaacacgattggatcccttgaaaatcactacctattcaaacacaaa
aatcatcctcgaaggtctcgaagaagtgctcttcatatcactaagaggttatctgatgat
gatcgtgtgatatgggctgaacaacaatatcaaaaagagagaagcaaacgttcagttcaa
agagactcagcattgaatctcttcaatgacccaatgtggaatcagcagtggtacttgcaa
gacactaggatgaccgcagctcttcccaagctggatcttcacgtgataccagtttggcaa
aagggcatcacaggcaaaggagttgttattactgtactggatgatggcttggagtggaat
cacacagacatatatgccaattacgatccagaggctagctatgattttaatgataatgat
cacgatccatttcctcggtatgatcccacaaatgaaaacaaacatggaactagatgcgca
ggagaaattgccatgcaagcaaataattacaagtgtggggttggagttgcatacaattcc
aaagttggaggcataagaatgctggacggcattgtaactgatgcaattgaggccagttca
attggcttcaaccctggccatgtggatatttacagtgcaagctggggccctaatgatgat
gggaaaactgtggaggggcctggaagactggcccagaaggcatttgaatatggtgtcaaa
caggggagacaagggaagggctccatctttgtttgggcttccgggaatgggggtcggcag
ggagataattgtgactgtgatggctacacagacagcatttacaccatctctatcagcagt
gcctcccagcaaggcctgtcaccctggtatgcagagaagtgttcctccacgctggccacc
tcctacagcagtggggattacacagaccagcgaataacaagtgccgacttgcacaatgac
tgcacagagacccacacaggcacctcagcctctgcacctctggctgctggcatctttgct
ctggccttggaagcaaatccaaacctctcttggcgagatatgcagcatctggttgtctgg
acctctgagtatgatccattggctaataacccaggttggaaaaagaatggtgcaggctta
atggtgaacagtcgatttggatttggtttgctaaatgccaaagctctggtggatctggct
gatcctaggacctggagaactgtgcctgagaagaaagaatgtgttgtaaaagacaataac
tttgagcctagagccctgaaagctaatggagaagtgactgttgaaatcccaacaagagct
tgtgaaggacaagaaaatgctatcaagtccctggaacatgtgcaatttgaagcaacaatt
gaatattctcgtagaggagaccttcatgtcacactcacttctgccgctggaaccagcacc
gtactgttggctgagagggagcgggatacatcccccaatggctttaagaattgggacttc
atgtctgttcacacatggggagagaatcctgtaggcacctggacattgaaaattacagat
ctgtctggaagaatgcaaaacgaaggcaggattgtgaactggaagctgattttgcatggg
acctcttctcagccagagcacatgaaacagccccgtgtgtacacgtcctacaacactgtc
cagaatgacaggagaggagtagagaagatggtgaatgtcatggaggagcagcccacacaa
aagagcctgaatgacagtcttctggtgccccaaagctccagcagcagcagtgtggagggc
agaagggacaagctggcacaaggggctccttcagaggctgtgctatggctcctacaaagt
gcttttagcaaaaacccaccttcaaagcaatcaccaaagaagtctccaggtgcaaagctc
agcatcccttatgagagtttctatgaagccctggaaaagctaaacaaaccctcccagctc
aaagactctgaggacagtctgtacagcgactatgttgatgttttctataatacaaaacct
tataagcatagagatgacaggctgctgcaagctcttgtggacattctgaatgaggaaaat
taa

DBGET integrated database retrieval system