KEGG   Cricetulus griseus (Chinese hamster): 100757784Help
Entry
100757784         CDS       T02813                                 

Gene name
Tgm1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100757784 (Tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 100757784
NCBI-ProteinID: XP_003502099
LinkDB All DBs
Position
Un
AA seq 844 aa AA seqDB search
MGGMGILGTGDLNGLEHSCLFFTGTMEGPRSDVGRWGGNPWQPPTTPSPEPEPEPDRRSR
SRRGGGRSFWARCCGCCSCGNRADDDWGPEPSGSRSRGSSSRGGRRPESRGSTVNAAGDG
IIREGMLVVTGVDLLCSRSDQNRREHHTDEFEYDDLIVRRGQPFHMVLSLNREYESSDRI
ALELLIGNNPEVGKGTHVIIPVGRGGSDGWKAQVTKTSGHNVNLRVHTSPNAIIGKFQFT
VRTRSEAGEFQLPFDPRNEIYILFNPWCPEDLVYVDHEDWRQEYVLNESGRIYYGTEAQI
GERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVSVCRVISAMVNSLDDNGVLIGNWT
GDYSRGTNPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNS
AHDTDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQ
ETSSGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAI
GTLIVTKAISSNMREDITHIYKHPEGSEAERKAVEKAAAHGSKPNVYATRDSAEDVAMQV
EAQDAVMGQDLAVCVVLTNRGSSRRTVKLHLYLSVTYYTGVTGPTFKETKKEVALAPGAS
DSVTMPVTYKEYKPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTVRRRLCV
GCRCRFQLNPEMPGWLPLLLFQLPSHSGSVFALDFTLSYSRLTGTVSVYRDIGGNETVTL
RQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPASGGGVFSDAGGDSHLEESIPMAS
RGGA
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggatgggcatcctgggcacaggcgatctgaatgggttagagcattcctgcctc
ttcttcacaggcacaatggaaggtcctcgctcagacgtgggccgctggggtgggaacccc
tggcagccccccaccacaccgtcgccagagccggagccagagccagatagacgctcgcgt
tcccgccgaggaggaggccgctccttctgggctcgctgctgtggctgctgctcgtgcggg
aacagagctgatgatgactgggggcctgaaccttctggctccagaagccgagggtccagc
tctcggggtggccggagacctgagtctcggggcagtactgtaaacgcagctggagatggc
atcatccgagagggaatgctggttgtgactggtgtggatctgctgtgctcacgctcggac
cagaaccgccgagagcaccacacggatgagtttgagtatgatgacctgatcgtgcgtcgt
gggcagcccttccacatggttctctccctgaaccgagaatatgagtcctctgatcgcatt
gcccttgagcttctcatcgggaacaatcctgaggtgggcaagggtacccacgtgatcatc
ccagtgggcagagggggcagcgatggctggaaggcccaagtgaccaagaccagtggacac
aacgtaaacctacgcgtccatacctcccctaatgccatcatcggcaaatttcaattcact
gtccgcacacgctcagaagctggggagttccagttaccctttgacccccgcaatgagatc
tacatcctcttcaacccctggtgcccagaggacttagtgtatgtggaccatgaggactgg
aggcaagaatatgtgctaaatgagtctggaagaatctactatggaaccgaagcacagatt
ggcgaacggacctggaattatggccagtttgatcatggggtgctggatgcctgtttgtac
atcctggatcggagagggatgccatatggaggccgtggggacccagtcagtgtctgccgg
gtcatctcagccatggtgaactccctggatgacaatggagtcctgattgggaactggact
ggcgattactctcgaggcaccaacccctcagcgtgggtgggcagcgtggagatcctgctt
agctatctacgcaccggctattctgtgccctatggccaatgctgggtctttgctggtgtt
accaccacagtgctgcgatgcctgggccttgctacccgtactgtcaccaacttcaactct
gcccatgacacagacacatccctcactatggacatctactttgatgagaatatgaaacca
cttgagcatctgaaccatgattctgtttggaactttcatgtgtggaatgattgctggatg
aagaggccagatctaccctcaggctttgatgggtggcaggttgtggatgccacaccccag
gaaaccagcagtggcatcttctgctgtggcccctgctccgtggagtccatcaagaatggc
ttagtctacatgaagtatgacacgcccttcatttttgccgaggtgaacagtgataaggtg
tactggcaacgacaggatgatggcagcttcaagattgtgtatgtggaggaaaaagccatt
ggcacgctcattgtcacaaaggccatcagctccaacatgcgcgaggacatcacccacatc
tataagcacccagaaggctcagaagcagagcggaaggctgtggagaaggctgctgcccat
ggcagcaaacccaatgtgtatgccacccgggactctgctgaggacgtggcaatgcaagtg
gaggcacaggatgctgtgatgggacaggatctggccgtctgcgtggtgttgaccaatcgc
ggcagcagccgccgcactgtaaagctgcacctctacctctctgtcacctactacacgggt
gtcactgggcctaccttcaaggagaccaagaaggaagtggcactagccccaggagcctcg
gactctgtgaccatgcctgtgacctacaaggaatacaagccccaccttgtggaccagggg
gcaatgttgctcaatgtctcaggccatgtcaaggagagcgggcaggtactagctaagcag
cacaccttccgtttgcgcaccccagatctctctcttacggtgaggcggaggctctgtgtg
ggttgtaggtgtagattccagctgaacccagaaatgcctggatggctccccctcttgctc
tttcaacttcctagccactctgggtcagtctttgctcttgactttacccttagttactca
aggctcactggtactgtctctgtctacagggacatcgggggaaatgagacagtcacactg
cgccagacatttgtgcctgtgcgaccaggcccccgacagctcattgccagcctggacagc
ccacagctctcccaagtacatggtgtcatccaagtggacgtggccccagcctctggcggt
ggagttttctcagatgctggaggtgacagtcacttagaggagagcatacctatggcatct
cgaggtggagcttag

DBGET integrated database retrieval system