KEGG   Cricetulus griseus (Chinese hamster): 100758055Help
Entry
100758055         CDS       T02813                                 

Gene name
Ezh2
Definition
(RefSeq) enhancer of zeste 2 polycomb repressive complex 2 subunit
  KO
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Lysine degradation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100758055 (Ezh2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100758055 (Ezh2)
Enzymes [BR:cge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100758055 (Ezh2)
Chromosome [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100758055 (Ezh2)
   Polycomb group proteins
    PRC2-EZH2 complex
     100758055 (Ezh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 746 aa AA seqDB search
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEW
KQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPDEREEKQKDLEDSQDDKESCPPRKFPADKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFH
ATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPN
NSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSVIAPV
PTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQ
NFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGE
ELFFDYRYSQADALKYVGIEREMEIP
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggccagaccgggaagaaatctgagaagggaccggtttgttggaggaagcgtgtaaaa
tcagagtacatgagactgagacagctcaagaggttcagaagagcagatgaagtaaagact
atgtttagttccaatcgtcagaaaattttggaaagaacggaaaccttaaaccaagaatgg
aagcagcgaaggatacagcctgtgcacatcatgacttctgtgagctcattgcgcgggact
agggagtgttcagtgaccagtgacttggattttccagcacaagtcatcccattaaagacc
ctgaatgcagttgcatcggtgcccataatgtattcttggtctcccttacagcagaatttt
atggtggaagatgaaactgttttacataatattccttatatgggggatgaagttctggat
caggatggcactttcattgaagaactaataaaaaattatgatgggaaagtgcatggagac
agagaatgtggatttataaatgatgaaatttttgtggagttggtaaatgctcttggtcaa
tataatgatgatgacgatgatgatgatggagatgatcctgatgaaagagaagaaaaacag
aaagatctagaggatagtcaagatgataaagaaagttgccctcctcggaaatttcctgct
gataaaatttttgaagccatttcctcaatgtttccagataagggaacagcagaagaacta
aaagaaaaatataaagagctcaccgagcagcagctcccgggtgctctgcctcccgaatgc
accccaaacatagatggaccaaatgctaagtctgttcagagggagcaaagtctacattca
tttcatactctcttctgtcggcggtgttttaagtatgactgcttcctacatcccttccac
gcaacacccaatacatataaacggaagaacacagaaacagctctggacaacaagccttgt
ggaccacagtgttaccagcatctggagggagctaaggagtttgctgctgccctcactgct
gagcggataaaaacaccacccaaacgtccagggggccgaagaagaggaagacttccaaat
aatagtagcagacccagcacccctaccatcagtgtgctggagtcaaaggatacagacagt
gacagggaagcaggaactgaaactggaggagagaacaatgataaagaagaagaagagaag
aaagatgaaacttccagctcctctgaagccaattctcggtgtcaaacaccaataaagatg
aagccaaatattgaacctcctgagaatgtggagtggagtggtgctgaagcctcaatgttt
agagtcctcatcggtacttactacgataatttttgtgccattgctaggctaattgggacc
aaaacatgtagacaggtgtatgagttcagagtcaaagagtccagtgtcatagcacctgtc
cctactgaagatgtggacactcctccgagaaagaagaaaagaaaacaccggttgtgggct
gcgcactgcagaaagatacaactgaaaaaggacggctcctctaaccatgtttacaactat
caaccctgtgaccatccacgacagccttgtgacagttcgtgcccttgtgtgatagcacaa
aatttttgtgaaaagttttgtcaatgtagttcagagtgtcaaaaccgctttcctggatgc
cggtgcaaagcacagtgcaacaccaagcagtgtccatgttacctggctgtccgagagtgt
gaccctgacctctgtctcacatgtggagctgctgaccactgggacagtaaaaatgtatcc
tgcaagaactgcagtattcagcggggctctaaaaagcacttactgctggcaccgtctgat
gtggcaggctggggaatctttatcaaagatcctgtacagaaaaatgaattcatctcagag
tactgtggagagatcatttctcaggatgaagcagacagaagagggaaagtgtatgacaag
tatatgtgcagcttccttttcaacttgaacaacgattttgtggtggacgcaacccgaaag
ggcaacaaaattcgttttgctaatcattcagtaaatccaaactgctatgcaaaagttatg
atggttaacggtgatcacaggataggcatctttgctaagagagctatccagactggtgaa
gagctgttttttgattacagatacagccaggctgatgccctgaagtatgtgggcatcgaa
agagaaatggaaatcccttga

DBGET integrated database retrieval system