KEGG   Cricetulus griseus (Chinese hamster): 100763780Help
Entry
100763780         CDS       T02813                                 

Gene name
Nsd2, Whsc1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00310  Lysine degradation
cge05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100763780 (Nsd2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100763780 (Nsd2)
Enzymes [BR:cge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100763780 (Nsd2)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100763780 (Nsd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET HMG_box PHD HMG_box_2 zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 100763780
NCBI-ProteinID: XP_007620947
LinkDB All DBs
Position
1
AA seq 1369 aa AA seqDB search
MEFSIRKSPLSVQKVVKCMKMKQAPEILGNANGKTQNCEVNHECSVFLSKAQLSNSLQEG
VMQKFNGHDALPFLPAEKLKDLTSRVFNGEPGAAHDAKLCFESQEVKGIGTPPNTTPIKN
GSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKSDNKTRRNRKRSIKYDSLL
EQGLVEAALVSKISSPADKKIPVKEESCPNTGKDLSLKYSVGDLVWSKVSGYPWWPCMVS
ADPLLHNHTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEEQFEKLCQESAKQA
PTKAEKIKLLKPISGRLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVAK
EAGIVEEPLGEMVDSSGASEDVAADPGCMKEEDIPMKRRRRVKRSSSAENQESDPRTEKS
TPPKIAEAEPKRGVGSPPGRKKSTASAPRSRKGDSASQFLVFCQKHRDEVVAEHPDVSGE
EIEELLGSQWNMLNEKQKARYNTKFSLMTSAQSEEDSGNINGKKRNHTKRTDDPPEDIDV
EDAPRKRLRTDKHSLRKRETINDKTARTSSYKAIEAASSLKSQAATKNLSDACKPLKKRN
RASATASSALGFSKSSSPSASLTENEVSDSPGDEPSESPYESADETQTEASVSSKKSERG
VAAKKEYVCQLCEKTGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCTECASGIHSCFVCK
ESKMEVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHATNPSNPRPSKGK
MMRCVRCPVAYHGGDACLAAGCSVIASNSIICTGHFTARKGKRHHTHVNVSWCFVCSKGG
SLLCCEACPAAFHPDCLNIDMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHP
KNVPPNIQKMKHEIGEFPAKKKKDFPVFQVKFQERYGDFLVEHRCCLKGQCICLLKYISI
VGLLALQEAEARFNEVKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKC
NCKPTDENPCGSDSECLNRMLMFECHPQVCPAGEYCQNQCFTKRQYPETKIIKTDGKGWG
LVAKRDIRKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNY
SRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGAS
NCSGFLGDRPKNSTSLSSEEKGKKTKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDR
KFCTKAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFRST
QDGQSYCCEHDLRAESARSTKTEKPFPESLKSKGKRKRRRCWRRVTEGK
NT seq 4110 nt NT seq  +upstreamnt  +downstreamnt
atggaatttagcatcagaaaaagccctctttctgtccagaaagttgtaaagtgcatgaag
atgaagcaggcaccagaaatccttggcaatgcaaatgggaagactcagaactgtgaagtg
aatcatgaatgttctgtattcctcagcaaagctcaactctctaacagcctacaggagggg
gtcatgcagaaatttaatggccatgatgcactcccctttcttccagcagagaagttgaaa
gatcttacttcccgtgtgtttaatggagaacctggtgctgctcatgatgctaaattgtgt
tttgagtctcaggaagtgaaaggaattggtacaccacccaatactacccctattaaaaat
ggctctccagaaattaaactgaaaatcacaaaaacatacatgaatgggaaacctctcttt
gaatcttcaatatgtggtgacagtgctgctgatgtgtctcagtcagaagaaaatggacaa
aaatcggataataagactaggaggaacaggaagaggagcataaaatatgactctttactg
gagcagggccttgtggaagcagctttagtgtccaagatctcaagtcctgcagataaaaag
atcccagttaaggaggagtcctgtccaaatactggcaaagacctctcgttgaaatacagt
gtgggtgatttggtgtggtccaaagtgtcaggttacccttggtggccttgcatggtttct
gctgatccactccttcacaatcataccaagcttaaaggtcagaaaaaaagtgcacgtcag
tatcatgtacaattctttggtgatgccccagaaagagcttggatatttgagaagagcctt
gttgcttttgaaggagaagaacaatttgaaaaattatgccaagaaagtgccaagcaggca
cccacgaaagctgagaaaatcaagttgttaaaacctatttcagggagattgagagcccag
tgggaaatgggcattgttcaagcagaggaagctgctagcatgtcagtagaggagcggaaa
gccaaatttaccttcctttatgtgggggaccagctacacctcaatcctcaagtagctaag
gaggctggcattgttgaagaacctttgggagaaatggtggactcgtcaggagccagtgaa
gatgttgctgcagaccctgggtgtatgaaagaagaggatattcccatgaagagaaggcga
agagtcaaaaggtctagttctgctgagaaccaagagagtgaccctagaacagaaaagagt
acccctccaaagattgcagaggctgaacctaagagaggagtaggctctcctcctggaagg
aagaagtccacagcttctgctccacggagcaggaaaggagactccgcatcccaattttta
gtcttctgtcaaaaacatagggatgaggttgtagctgaacatccagatgtctcaggagag
gagattgaagaattacttggatcccagtggaatatgctcaatgaaaagcagaaagcacga
tataatacaaagttttccctaatgacctctgcccagtctgaagaagactctggtaatata
aatgggaaaaaaagaaaccacacaaagaggacagatgaccctccagaagacatcgatgtt
gaagatgcacccaggaaaagacttaggacagataagcacagtcttcggaagagagagaca
atcaacgacaagacggccagaacaagctcttacaaggccattgaggcagcctcctcactc
aagagccaggcagcaacgaaaaatctgtctgatgcttgcaaaccactgaagaagcgaaat
cgggcttctgcaacagcgtcttcagcacttgggtttagcaaaagttcatctccttctgca
tccttaactgagaatgaggtctcagacagcccaggagatgagccctcagagtctccatat
gaaagtgcagatgaaacacagaccgaagcatccgtctcatctaaaaagtctgaaagagga
gtagctgccaaaaaggagtacgtgtgtcagttgtgtgagaagacaggcagcctcttgttg
tgtgagggcccctgttgtggagcattccatctagcctgccttggactttcccgaagacca
gaaggaagattcacctgcactgaatgtgcctcagggattcattcatgctttgtgtgtaaa
gaaagcaagatggaggtgaagcgctgtgtggtaactcagtgtggaaagttttaccacgaa
gcttgtgtaaaaaagtaccctctcactgtgtttgagagccgaggctttcgatgccctctc
cacagctgtgtgagctgccatgccacaaacccttcaaatccacggccatcaaaaggtaaa
atgatgcgatgtgtccgatgccctgttgcctatcatggaggggatgcctgtctggcagca
ggatgttcagtgattgcttctaatagcataatctgcacaggccacttcactgctcggaag
gggaagcggcaccacacccacgtcaatgtgagttggtgcttcgtgtgctccaaaggggga
agtcttctatgctgtgaggcttgcccagcagccttccaccctgattgcctgaatatagat
atgcctgatggcagctggttctgcaatgactgccgggctgggaagaaactacattttcaa
gacatcatttgggtcaaacttgggaactacagatggtggccggcagaagtttgccatccc
aaaaatgttcccccaaatattcagaaaatgaagcacgagattggagaattccctgccaag
aagaagaaagactttcctgtatttcaggtgaagtttcaagaacggtatggagatttccta
gtggagcatagatgctgcttaaaaggtcaatgtatttgtttactaaaatatatttctatt
gttggccttttagcactgcaagaagctgaagctcgttttaatgaagtcaaacttcagcgg
gaagctcgagaaacacaggagagtgagagaaagcctcccccatacaaacatatcaaggtg
aataagccatatggtaaagtccagatctatacagctgacatttctgaaatcccaaagtgc
aactgtaagcccacagatgagaacccgtgtggctctgattctgagtgtctaaacaggatg
ctgatgtttgagtgccatccacaggtgtgtcctgcaggtgaatactgccagaaccagtgt
ttcactaagcgccagtaccctgagaccaagatcatcaagacagatggcaaagggtggggc
ctggttgccaaaagggacatcagaaagggagaatttgttaatgaatatgttggtgagctg
attgatgaagaggagtgtatggcaagaatcaaatatgcacatgagaatgacattactcac
ttttacatgctcaccatagacaaggaccgaataattgatgctggccctaaagggaattat
tcaagattcatgaaccatagctgccaacccaattgtgagactctgaagtggacagtgaat
ggggacactcgggttggcctgtttgctgtgtgtgacattcctgcagggacagagctgact
ttcaactataacctcgattgtttgggcaatgaaaagacagtctgtcggtgtggagcctcc
aattgtagtgggtttcttggagacagaccaaagaactcaacatccctttcttcagaggaa
aagggtaaaaagaccaagaagaaaaccagaaggcgaagagccaaaggggaagggaagcgg
cagtcagaggatgagtgcttccgctgtggtgatggtggacagctggtgctgtgtgaccga
aagttctgtaccaaggcctaccacctgtcctgcctgggcttgggcaagcggccctttggg
aagtgggaatgtccttggcatcactgtgatgtatgtggcaaaccttctacctcattttgc
cacctgtgccccaactcattctgtaaggaacaccaagatgggactgcctttcgttccacc
caggatgggcaatcctactgctgtgagcatgatttgagggcagaatccgcaagaagtacc
aagactgagaaaccctttccagaatcactgaagtcaaaggggaagaggaagagaaggcgg
tgttggcgaagggtcacagaaggcaaatag

DBGET integrated database retrieval system