Cricetulus griseus (Chinese hamster): 100764983 Help Entry 100764983         CDS       T02813                                  Name (RefSeq) tumor suppressor ARF isoform X2   KO K06621   cyclin-dependent kinase inhibitor 2A Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge01522   Endocrine resistance cge01524   Platinum drug resistance cge04110   Cell cycle cge04115   p53 signaling pathway cge04218   Cellular senescence cge04934   Cushing syndrome cge05163   Human cytomegalovirus infection cge05166   Human T-cell leukemia virus 1 infection cge05200   Pathways in cancer cge05203   Viral carcinogenesis cge05206   MicroRNAs in cancer cge05212   Pancreatic cancer cge05214   Glioma cge05218   Melanoma cge05219   Bladder cancer cge05220   Chronic myeloid leukemia cge05223   Non-small cell lung cancer cge05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:cge00001]  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100764983    04115 p53 signaling pathway     100764983    04218 Cellular senescence     100764983  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100764983    05206 MicroRNAs in cancer     100764983    05203 Viral carcinogenesis     100764983   09162 Cancer: specific types    05212 Pancreatic cancer     100764983    05225 Hepatocellular carcinoma     100764983    05214 Glioma     100764983    05220 Chronic myeloid leukemia     100764983    05218 Melanoma     100764983    05219 Bladder cancer     100764983    05223 Non-small cell lung cancer     100764983   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100764983    05163 Human cytomegalovirus infection     100764983   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100764983   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100764983    01522 Endocrine resistance     100764983 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P19Arf_N Motif Other DBs NCBI-GeneID:  100764983 NCBI-ProteinID:  XP_027256201 UniProt:  A0A9J7FCD2 LinkDB All DBs Position 2:58853404..58874745 Genome browser AA seq 146 aa AA seqDB search MGRGRRFSPPVSHGGDRWASAAAGSMGYRFLVTVRIRRRRADRPPRVRAFVVQFPRSSRH RSASRARAVVALLLMLARSQRGPRLHPGAGHDDGQHPSSQTAAALRCRTELRGPSHPLPT RARCSAGGLLGNSEDTAPGGGAAGCA NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgggccgggggcggcgcttctcacctcccgtgtcacacggaggcgaccgctgggcgagt gcagcggctgggagcatggggtacaggttcctggtgactgtgcggattcggcggcggcgc gcagatcgcccacctcgagtgagggctttcgtggttcagttcccgcgatcttcgcgacac cggtcagcgagccgcgcacgggccgtagtggccctgctgttgatgctagcgaggagccag cgagggccgcggctgcatcctggagcaggtcatgatgatgggcaacacccaagtagccag actgctgctgctctacggtgccgaaccgaactgcgaggacccagccaccctctcccgacc cgtgcacgatgcagcgcgggagggcttcttggaaactctgaagatactgcaccaggcggg ggcgcggctggatgtgcatga

DBGET integrated database retrieval system