KEGG   Cricetulus griseus (Chinese hamster): 100766171Help
Entry
100766171         CDS       T02813                                 

Gene name
Hdac7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Alcoholism
Human papillomavirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cge00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100766171 (Hdac7)
  Substance dependence
   05034 Alcoholism
    100766171 (Hdac7)
  Infectious diseases
   05165 Human papillomavirus infection
    100766171 (Hdac7)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100766171 (Hdac7)
Chromosome [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100766171 (Hdac7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 919 aa AA seqDB search
MDLRVGQRPTVEPPPEPALLALQHPQRLHRHLFLAGLQQQQRSAEPMRLSMDPPVPELQG
AQQEQELRQLLNKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPSSPSIPYRTLEP
LDTEGAARSMLSSFLPPVPSLPTEAPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRK
ESAPPSLRRRPAEPLGDSSPSSSSTPASGCSSPNDSEHGPNPALGSEADGDRRTHSNLGP
RGPVLGNPHAPLFLHHGLEPDAGGTLPSRLQPILLLDPSVSHAPLWTVPGLGPLPFHFAQ
PLLTTERLSGSGLHRPLNRTRSEPLPPSATASPLLGPLQPRQDRQDRLKPHVQLIKTAIS
PPQRPAKPSEKPRLRQIPSAEDLETDGGGVGAVVNDGLEHRESGHGPPEGRGPVSLQQHQ
QVPLWEQQHLAGRLSQGSSGDSALLPLAQVGHRPLSRTQSSPAAPVSLLSPEPTCQTQVL
TSSETPATGLVYDSVMLKHQCSCGDNSKHPEHAGRIQSIWSRLQERGLRSRCECLRGRKA
SLEELQSVHSERHVLLYGTNPLSRLKLDNGKLTGLLAQRMFVMLPCGGVGVDTDTIWNEL
HSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQL
QQQGKASKILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGTGNG
EGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFAPDLVLVSAGFDAAEGHPAPLGG
YHVSAKCFGYMTQQLMTLAGGAVVLALEGGHDLTAICDASEACVAALLGNKVDLLSEEGW
KQKPNPNAIRSLEAVIRVHRKYWGCMQRLASCPDSWLPRVPGADAEVEAVTALASLSVGI
LAEDRPSEQLVEEEEPMNL
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcgcgtgggccagcggcccacagtggagcccccaccggagcctgcgctgcta
gccctgcagcacccccagcgattgcaccgccatctcttcctggccggcctgcaacagcaa
cagcgctcagctgagcccatgaggctctcaatggacccaccagtgccggagctgcagggg
gcgcagcaggaacaagaacttcgacagcttctcaataaagacaagagcaagcgaagtgcc
gtagccagcagtgtggtcaagcagaagctggctgaggtgatcctgaagaaacagcaggca
gctcttgagagaacagtccatcccagcagccccagtattccttacagaactcttgagccc
ttggacacagagggtgctgcccgctccatgcttagcagcttcctgcctccagttcccagc
ctgcccactgaagccccggaacactttcccctgcgtaaaacagtgtctgagcccaacctg
aagctgcgctataagcccaagaagtccctggaacggcgcaagaatcccctgctcagaaag
gagagtgccccacccagccttcggcggaggcctgcagagccccttggagattcctccccc
agtagtagcagcactcctgcctcggggtgcagctcccccaatgacagcgagcatggcccc
aaccctgccctgggctcagaggccgatggtgaccgcaggacccattcgaatttgggccct
cggggtcctgttctggggaaccctcatgctcctctcttcctgcaccatggtctggagcca
gatgctgggggcaccttaccgtctcgcctgcagcccattctcctgctggatccctcagtc
tcccatgccccactatggactgtgcctggacttgggcccctgcccttccattttgcccag
cccttactgaccaccgagcggctctctgggtcaggcctccaccggccacttaaccggaca
cgctcagagcccctgccccccagcgccactgcctcccctctgctgggccccctgcagccc
cgccaggatcgccaggatcggctcaaacctcatgtccagctcatcaagacagccatctcc
cctccccagaggcccgccaagccgagtgagaagccccgactgcggcagataccctcagct
gaggacctagagacagatggtgggggagtgggagctgtggtgaatgatggcctggaacat
agggagtcaggccacgggcctcccgagggcagaggccctgtttctctgcagcagcaccaa
caggtgccactctgggagcagcagcatcttgctgggcgactttcccagggaagctccggc
gactctgcgctgctacctctggcccaggtgggacaccggcccctgtccagaactcagtct
tccccagcggcacctgtttccctgctgagcccagagcccacctgtcagacccaagtcctc
accagctcagaaacacctgccacagggctggtctatgactcggtgatgctgaagcaccag
tgctcctgtggagacaacagcaagcaccccgagcatgcaggccgcatccagagcatctgg
tcccggctgcaggagcgaggtctccgaagccggtgtgagtgtctccgaggccgaaaggcc
tccctagaggagctgcaatcagtccactctgaaaggcatgtactcctctacggcaccaac
cccctcagccgcctcaaactggataatgggaagctgacaggactcctggcacagcggatg
tttgtgatgctaccctgtggtggggttggggtagatactgacaccatctggaacgagctg
cattcctccaatgcagcccgctgggctgcaggcagtgtcaccgaccttgcattcaaagta
gcttcccgagaactaaagaatggttttgctgtggtgcggcccccaggacaccatgcagat
cattctacagccatgggcttttgcttcttcaactctgtggccattgcctgccgacagcta
caacagcaaggcaaagccagcaagatcctcattgttgactgggatgttcaccatggcaat
ggcacacagcaaactttctaccaggaccccagcgtgctgtacatctccttgcatcgccat
gatgatggcaacttcttcccaggcagtggggctgtggatgaggtggggactggcaatggc
gaaggcttcaacgtcaatgtggcttgggctgggggcttggatccacccatgggggatcct
gagtacctggctgccttcaggatagtggtgatgcccattgcccgagagttcgctccagac
ctggtcctggtgtctgctggttttgatgctgccgagggtcacccagcaccactgggtggc
taccatgtttctgccaaatgttttgggtatatgacacagcaactgatgaccttggcagga
ggtgcagtggtattggccttagagggtggccatgacctcacagccatctgcgatgcctct
gaggcctgtgtggctgctcttctgggcaacaaggtggatctcctttcagaagaaggctgg
aaacagaaacccaaccccaatgccatccgctctctggaagctgtgatcagggtgcacagg
aaatactggggctgcatgcagcgcttggcttcctgtccagactcctggctgcccagagtg
ccaggggctgacgcagaagtagaagctgtgactgcactggcatcactctccgtgggcatc
ctggctgaagacaggccctcagagcagctggtagaagaggaagaacctatgaatctctag

DBGET integrated database retrieval system