KEGG   Cricetulus griseus (Chinese hamster): 100766830Help
Entry
100766830         CDS       T02813                                 

Gene name
Tufm
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Translation factors [BR:cge03012]
 Eukaryotic Type
  Elongation factors
   100766830 (Tufm)
 Prokaryotic Type
   100766830 (Tufm)
Mitochondrial biogenesis [BR:cge03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    100766830 (Tufm)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100766830 (Tufm)
  Exosomal proteins of breast cancer cells
   100766830 (Tufm)
  Exosomal proteins of colorectal cancer cells
   100766830 (Tufm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 100766830
NCBI-ProteinID: XP_003511122
UniProt: G3I7M2
LinkDB All DBs
Position
Un
AA seq 452 aa AA seqDB search
MAAATLLRATPRFSGLCASPTPILQGRLRPLKARASPFLCRGLAVEAKKTYVRDKPHVNV
GTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAAR
HYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYV
NKADAVQDSEMVELVELEIRELLTEFGYKGEEAPVIVGSALCALEQRDPELGVKSVQKLL
DAVDTYIPVPTRDLEKPFLLPIESVYSIPGRGTVVTGTLERGILKKGDECELLGHNKNIR
TIVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIQPHQKVEAQVYILT
KEEGGRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAMPGEDLKLSLVLRQPMILEKGQ
RFTLRDGNKTIGTGVVIDIPAMTEEDKNIKWS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgctaccctattgcgagcgacgccccgcttcagcggtctctgcgccagcccg
accccaattctgcaaggtcggctgcggccgctgaaggcccgggcatcgcccttcttatgt
cgcggcctagccgtggaggccaagaaaacctacgtgcgtgacaagccccatgtgaatgtg
ggtaccattggccatgtggaccacggcaagaccaccctgaccgcggccatcacgaaaatt
ctagccgagggaggtggagctaagttcaagaagtacgaggagatagacaatgcccctgag
gagcgagctcggggtatcaccatcaatgcagctcatgtggagtatagcactgctgcccga
cactatgcccacacagactgccctggtcatgcagattatgttaagaatatgatcacaggc
actgccccgctggatggctgcatcctggtggtggcagctaatgacggccccatgccccag
acccgagagcacttactactggctaaacagattggggtagagcatgttgtggtgtacgtg
aacaaggcagatgctgtccaggactcagagatggtggagctggtggagctggagatccgt
gagctgctcaccgagtttggatataaaggagaggaggccccagtcatcgtaggctctgct
ctctgcgcccttgagcaacgtgaccctgagctaggtgtgaagtcagtacagaagctgctg
gatgcagtggacacttacatcccagtgcccacccgggacctggagaagccctttctgctc
cccatagagtcagtttattctattcctggccggggcacggtggtgacaggtacactagag
cgtggcattttgaagaagggagatgagtgtgagttgctaggacataacaagaacattcgc
acaatagtgacaggcattgagatgttccacaagagccttgagagggctgaggcaggggat
aacctgggtgctctggtccgaggcctaaagcgggaagatttgaggcgaggcttggtcatg
gtcaagccaggctccatccagccccaccagaaggtggaggcccaggtttacatcctcacc
aaggaggagggtggccgccacaaaccatttgtatctcattttatgcctgtcatgttctcc
ctgacttgggacatggcctgtcgtgtcatcttgcctccagggaaggagcttgccatgcct
ggagaggatttaaagctcagcctagttttgcggcagcccatgatcttagagaaaggccag
cgtttcactttgagggatggcaacaagaccattggcactggtgttgtcattgacatacca
gccatgactgaagaggacaagaacatcaagtggagctga

DBGET integrated database retrieval system