KEGG   Cricetulus griseus (Chinese hamster): 100771642Help
Entry
100771642         CDS       T02813                                 

Gene name
Entpd2
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 2
  KO
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Purine metabolism
Taste transduction
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100771642 (Entpd2)
 Organismal Systems
  Sensory system
   04742 Taste transduction
    100771642 (Entpd2)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     100771642 (Entpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 495 aa AA seqDB search
MAGKLLSLLPPLLLAAVGLAGLLLLCVPTQDVREPPSLKYGIVLDAGSSHTSMFVYKWPA
DKENDTGIVGQHSSCDVQGGGISSYADDPSGAGQSLVECLEQALGDVPKDRHASTPVYLG
ATAGMRLLNLTNPEATARVLEAVTQTLTQYPFDFRGARILSGQDEGVFGWVTANYLLENF
IKYGWVGRWIRPRKGTLGAMDLGGASTQITFETTRPSEDPDSEVHLRLYGQHYRVYTHSF
LCYGRDQVLKRLLASALQIHHFHPCWPKGYSTQVLLRDVYQSPCTMDQRPHDFNSSAIVS
LSGTSSPALCRDLVSGLFNFSFCPFSQCSFNGVFQPPVTGSFIAFSAFYYTVDFLRTVME
LPVGTLQQLEAATEIVCNQTWAELQARVPRQEARLADYCAGAMFIQQLLSRGYRFDEHSY
RGVVFQKKAADTAVGWALGYMLNLTNMIPADLPRLRKGTHFSFWVALLLLFAILLLAALV
LLLRQVRSTKSPGAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaagttgctgtcactgttgccacccctgctgctggctgcggtgggtctcgcc
ggtctcctgctgctgtgcgtcccaacccaagacgtccgggagccgccctccctcaagtac
ggcatcgttctggatgctggctcttcacacacatctatgtttgtctacaagtggccagca
gataaagagaatgacacaggcatcgtgggccagcacagctcttgtgatgttcaaggtggg
ggcatctccagctatgcagatgacccttctggggcgggccagagtctggttgaatgtctg
gaacaggcacttggtgatgtgcccaaagacagacatgccagcacaccagtctacctggga
gctacagcaggcatgcgtctattgaacctgaccaatccagaggccacagccagggtgctc
gaggcagtgacacagacgctcacacagtacccctttgacttccgtggtgctcgtatcctc
tcgggacaggatgaaggagtgtttggctgggtgactgccaactacctgctggagaacttc
atcaagtatggctgggttggccggtggattcggccaaggaagggaactctgggggccatg
gatcttgggggtgcctcaacacagatcacctttgagacgaccaggccatctgaagatcca
gacagtgaggtccatctgcgactctatggccagcactatcgtgtctatacccacagcttc
ctctgctatggccgggaccaggttctgaagaggctgctggccagtgctctccagatccat
cacttccacccctgctggccaaagggctactccacccaagtgctgcttcgggacgtctac
cagtcaccatgcactatggaccagcgtcctcatgacttcaacagcagtgccattgtcagc
ctttcggggaccagcagccctgctctctgtcgtgacctagtctctgggctcttcaacttc
tccttctgtcccttttcccagtgctccttcaatggggtcttccagccccctgtgactggg
agcttcattgccttttcggctttctactatactgtggacttcctaaggacggtgatggag
ctgcctgtgggaaccctgcagcagctggaggcagccacggagattgtctgcaaccagacc
tgggctgagcttcaggcccgagttccaaggcaggaggcccgcctggctgactactgcgcc
ggagccatgttcatacaacagctgctaagtcgcggctatcgctttgatgagcactcttac
agaggagtggtcttccaaaagaaggctgcagacacggctgtcggctgggcgctgggctac
atgctaaatttgaccaacatgattcccgctgaccttccaagactacgtaaaggaactcac
ttcagcttctgggtcgctcttctcctgctcttcgcaatcctgctcttggcggcgttggtc
ctgctcctgcgccaggtgcgctccaccaagtccccaggcgccctctag

DBGET integrated database retrieval system