KEGG   Cricetulus griseus (Chinese hamster): 100774155Help
Entry
100774155         CDS       T02813                                 

Gene name
Setdb2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100774155 (Setdb2)
Enzymes [BR:cge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100774155 (Setdb2)
Chromosome [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100774155 (Setdb2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100774155 (Setdb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
1
AA seq 695 aa AA seqDB search
MGERNGDARTFWMELQDDGKVDFMFEKTQDVLQSLKQKIKDGSATNRDYAQAMILVNEAT
ISNSPTKDHIPVTQNEQENKSNAFPSTSCENSFPEDCTILSTGNKASLLENIKSADLREK
EPPLSVSFHSHVCSSACLMQTPLSLKGENPLQLPIRCHFQRRHAKTNSHSSALHVNYKTP
CGRSLRNMDEVFHYLIETECNFLFTDNFSFNTYVQLTRNYPKQDAVVSELDISNGVESVP
ISFCNEIDSRKLPSFKYRKTTWPRACYLNFSSMFSDSCDCSEGCIDIKKCPCLQLTAKNA
KACPLSPDGMCTGYKYKRLKRLIPTGIYECNLLCKCNRQLCQNRVVQHGPQVRLQVFKSE
KKGWGVRCLDDIDRGTFVCIYSGRLLSRITPEKTNTDENAIEQQNIVKNMFSKKRKIEVV
CSDCETHPRSPKTEKCSPTNLNSDLEEPVVEMNYRNISRIQRHSVIRSPKFKTAVFHYNK
KNMEFVSSECADPEDKNGFKPAQEHINSKARAHEDLRSNQVGYSEDRQLIESDVIDITKN
KEDTSPDGKCKHIATLNTENTKKMLEVPVKKSQEKESAASHSQQVFCDEELPSERTKTPS
PSLMRLSKENVFLLDASKEGNVGRFLNHSCSPNLCIQNVFVETHDRNFPLVAFFTNRYVK
ARTELTWDYGYEAGTIPEKEILCQCGVNKCRKKII
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaagaaatggtgatgcaaggactttctggatggagttacaagatgatggtaaa
gtggattttatgtttgaaaaaacacaagatgtgctgcagtcgctgaaacagaagataaaa
gatgggtctgccacaaatagagactatgcccaagcaatgattctggtaaatgaagcaact
ataagtaacagtccaacaaaggatcatatacctgtgactcagaatgaacaggaaaacaaa
tcaaatgcatttccctctacatcatgtgaaaactcctttcctgaggactgtaccattcta
tctacaggaaacaaagcatccctgcttgagaacattaaatctgcagacctgagggagaag
gaaccccctttgagtgtatctttccatagccatgtctgctccagtgcttgtctaatgcaa
acaccactgtccttgaagggagaaaaccctctacagctacccatcagatgtcacttccaa
agacgacatgcaaagacaaactctcattcttctgctcttcacgtgaattataaaacacct
tgtggacggagtctaagaaacatggatgaagtttttcattaccttattgagacagagtgt
aactttttattcacagacaacttttctttcaatacttatgttcagttgactcggaattac
ccaaaacaagatgcagtagtttctgaattggatattagtaatggagtggaatcagtgcca
atttctttctgtaatgagattgacagtaggaaacttccatcatttaagtacagaaagaca
acgtggcctcgagcatgctatctaaatttttccagcatgttttctgattcatgtgactgt
tctgagggatgcatagacataaaaaaatgtccatgtcttcagttgacagcaaagaatgcc
aaagcatgtcccttgtcacctgatggaatgtgtactggatataaatataaaagactgaag
agactcatacctactggcatttatgaatgcaacctattgtgcaagtgtaaccgtcagttg
tgtcaaaaccgagtcgtccaacatggtccccaggtgaggctacaggtgttcaaaagtgag
aagaagggctggggagtacgctgcctggatgacattgacagagggacatttgtgtgcatt
tattcaggaagattactaagcagaatcactcctgagaaaactaatactgatgaaaatgca
atagaacaacagaacattgtgaaaaatatgttttccaaaaagaggaaaatagaagttgta
tgttcagattgtgaaacacatcctagaagtcctaaaactgagaaatgttctcctactaac
cttaacagtgatctcgaagagcctgttgtggaaatgaactatagaaatatttcaagaatt
cagcgtcactcagtcattagaagccctaaattcaagacagctgtttttcattacaataag
aaaaacatggaatttgtttcctcagagtgtgctgaccctgaagataagaatggatttaaa
ccagctcaagaacacataaactctaaagctagagctcacgaggacttaaggtcaaaccaa
gttggatattctgaagacagacagctgattgaatcagacgtgatagatataactaaaaat
aaagaagacacttcaccagatggcaagtgtaagcacatagccacattgaatactgagaat
actaaaaagatgcttgaagttccagtaaaaaagtcccaagaaaaagaatctgcagcctct
cacagtcaacaggtcttctgtgatgaagaattgccaagtgaaaggacaaagactccatca
ccttctctaatgaggctcagtaaagagaatgtatttctgttggatgcttcaaaagaagga
aacgtgggccgtttccttaatcacagttgttctccgaatctctgcatacagaacgttttt
gtagaaacacatgacaggaattttccattggtcgctttcttcaccaacaggtatgtgaaa
gcaagaacagaactaacatgggattatggttatgaagctgggaccatacctgaaaaagaa
atcctctgccaatgtggggttaataagtgtcggaaaaaaataatataa

DBGET integrated database retrieval system