KEGG   Cricetulus griseus (Chinese hamster): 103158533Help
Entry
103158533         CDS       T02813                                 

Gene name
Ace
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cge00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    103158533 (Ace)
   04614 Renin-angiotensin system
    103158533 (Ace)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    103158533 (Ace)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    103158533 (Ace)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103158533 (Ace)
Peptidases [BR:cge01002]
 Metallo Peptidases
  Family M2
   103158533 (Ace)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103158533 (Ace)
CD molecules [BR:cge04090]
 Proteins
  103158533 (Ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
7
AA seq 1301 aa AA seqDB search
WAPPPPLWLLWLPLLLLLLPPSPAPALDPGLQPGNFSADETGARLFAESYNSTAEQVLFQ
SVAAIWAYYTNITEENARLQEEAELIEQEFAEIWGKKAKELFDPIWQNFTDSKLRRAIEV
IRILGPANLLLAQRQQYNSLLNNMSRIYSTSKVCLPNKTATCWSLEPELTNILASSRSYA
KLLFAWESWHDVVGIPLKPLYQDFTTLSNEAYKQDGFSDTGAYWRSAYDSPSFEVTLEHL
YQQLEPLYLNLHAYVRRALHRRYGDKYINLRGPQLLGDMWAQSWDNIYDMVVPFPNKPNI
DVTNTMVQKGWNATYMFQVAEEFFTSLGLSPMPPEFWAESMLEKPTDGREVVCHASAFDF
FNRKDFRIKQCTRVTMEQLSIVHHEMGHVQYYLQYKDLAVPLRRGPNPGFHEAIGDVLAL
SVSTPAHLYKIGLLDHVANDIESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGHTPPS
RYNFDWWYLRTKYQGICPPVDRNETHFDAGAKFHIPNGTPYIRYFVSFILQFQFHQALCK
EAGHQGPLHQCDIYQSTQAGAKLRRVLQAGRSRPWQEVLKEMVGSDTLDAQALLEYFQPV
IQWLQEQNQRNDEVLGWPEYQWRPPLPDNYPEGIDLVTDEAEAERFVEEYDRTARVLWNE
YAEANWQYNTNITLEASKILLEKNKKVANHTLKYGTLAKKFDVSNFHNSTIKRIIKKVQN
MDRAVLPPKELEEYNQILMDMETTYSIANVCYTNGTCLHLEPDLTNLMATSRKYEELLWV
WKSWRDKVGRAILPLFPKYVEFSNKIAQLNGFADGGDSWRSSYESENLEEDLEQLYQELQ
PLYLNLHAYVRRSLHRHYGSEHINLDGPIPAHLLGNMWAQTWSNIYDLVAPFPSAPNLDA
TEAMVKQGWTPRRIFKEADDFFTSLGLLPVPAEFWNKSMLEKPTDGREVVCHASAWDFYN
GKDFRIKQCTSVNMEDLVIAHHEMGHIQYFMQYKDLPVTFQEGANPGFHEAIGDVLALSV
STPKHLHNLNLLSSEGGGYEHDINFLMKMALDKIAFIPFSYLMDQWRWRVFDGSITKENY
NQEWWSLRLRYQGLCPPLPRSQDDFDPGSKFHIPANVPYIRYFISFIIQFQFHEALCRAA
GHTGPLHKCDIYQSKEAGKLLADTMKMGYSKPWPEAMRLITGQSNMSASAMMSYFKPLTE
WLTTENRRHGETLGWPQYNWTPDTARSEGPFPESGRVNFLGMYLEPQQARVGQWVLLFLG
VSLLVATLGLTHRLFSIRQHHSLHRPHRGPQFGSEVELRHS
NT seq 3906 nt NT seq  +upstreamnt  +downstreamnt
tgggcgcccccgccgcctctctggctgctgtggctgcccctcctgctgctcctgctgccg
ccctcgcccgctccggcgctcgaccctggattgcagccgggcaacttttccgcggacgag
acaggggcacgtctcttcgccgagagctacaattcgactgccgagcaggtgctgttccag
agcgtcgcagccatctgggcgtactacaccaacatcaccgaggagaatgcgcggctccag
gaggaagcagaactcatcgagcaggagtttgcagagatctggggcaagaaggccaaggag
ctttttgatcccatctggcagaacttcactgactcaaagctacggagggccattgaagtt
atacgcatcctaggacctgccaacttgctcctggcccagcggcagcagtacaactccctc
ctaaacaacatgagcagaatctactccaccagcaaggtttgcttgcccaacaagactgcc
acctgctggtccctggagccagagctcaccaacatactggcttcctcacgaagctatgcc
aagctgctgttcgcctgggagagctggcatgatgttgtgggcataccactgaaacccctc
tatcaagactttaccaccctcagcaacgaagcctacaaacaagatggcttttcagacaca
ggagcctactggcgctccgcatatgactccccctcctttgaagtgactctggagcacctt
taccaacaactagaacccctctacctgaacctccatgcctacgtccgccgcgcactgcat
cgacgctatggggacaaatatatcaacctcagggggccccagctgctgggagacatgtgg
gcccagagctgggacaacatctacgacatggtagttcctttcccaaacaaacctaacatc
gatgtcaccaatacaatggtgcagaagggctggaatgccacatacatgttccaggtagca
gaggaattcttcacctcgctggggctctcaccgatgcctcctgagttctgggcggagtcg
atgctggagaagccaactgatgggcgagaggtggtgtgtcacgcctcagccttcgacttc
ttcaacaggaaggacttcaggatcaagcagtgtacacgggttacaatggagcagctttcc
atagtgcaccatgagatgggccacgtgcagtactacctacagtacaaggacctggctgtc
cccctgcgcagaggtcccaaccctggcttccacgaggccatcggggatgtgctcgctctc
tctgtctccactcctgcacatctgtacaaaatcggcctgctggaccatgttgctaatgac
atagaaagcgacatcaattacttgctgaagatggccctagagaaaattgccttcttgccc
tttggctacctggtggaccagtggcgctggggggtcttcagtggccacaccccaccctcc
cgctacaactttgattggtggtatcttagaaccaagtatcaagggatctgtcctccagtt
gaccggaatgaaacccattttgatgctggagccaagtttcatatcccaaacgggacaccg
tatatcaggtattttgtgagcttcattctacagttccagttccatcaagcgctgtgcaag
gaggcaggccaccagggcccgctacaccagtgtgacatctaccagtctacccaggctggg
gccaagctccggcgggtgctgcaggctggccgctccaggccctggcaggaggtactgaag
gagatggtgggctcagataccctggatgcccaggcactactggaatacttccaaccggtc
atccagtggctgcaggagcagaatcagaggaatgatgaagtcctaggctggccagagtat
cagtggcgcccaccgttacctgacaactatccagagggcattgacctagtgactgatgaa
gctgaggctgagaggttcgtggaggagtatgaccggacagcacgggtgttgtggaacgag
tacgcagaggccaactggcaatataacaccaacattaccctagaggccagcaagatcctg
cttgagaaaaacaagaaggtggccaaccacaccctgaaatatggcactctggccaagaag
tttgatgtgagcaactttcataactctaccatcaaacggatcataaagaaggttcagaac
atggaccgggcagtgctacctcctaaggagctggaagagtacaaccagatcctgatggac
atggagacgacttacagcatagccaatgtttgctacacaaatggcacttgtctgcatttg
gagcctgatctgacaaatttgatggccacatcccggaaatatgaagaactgttatgggtg
tggaagagctggagagacaaggtggggagagccatccttccccttttcccaaagtacgtg
gaattctccaacaagattgcccaactcaatggcttcgctgatggaggggactcatggagg
tcatcgtatgagtctgaaaacttggaggaagacctggaacaactgtaccaagagcttcag
ccactctacctgaacctacacgcctatgtgcgccgttccctgcaccgccattatggctct
gagcacatcaacctggatggccccattcccgcccacttgctggggaacatgtgggcgcag
acttggtccaatatctatgacttggtggcacctttcccttctgcccccaacttggatgcc
acggaggccatggtaaagcagggatggacacccagaaggatatttaaggaagctgatgat
ttctttacctccctggggctgttacctgtgcctgccgagttctggaacaagtcaatgttg
gagaagccaactgatggtagggaggtggtgtgccatgcctcggcctgggacttctacaat
ggcaaggacttcaggatcaagcagtgtacctctgtgaacatggaggacttggtgattgct
caccatgaaatgggacacatccagtatttcatgcagtacaaagacttgcctgtgaccttt
caggagggcgccaaccctggctttcacgaagctattggagatgtgctggctctgtcggtg
tctacccccaaacatctccacaatcttaacctgctcagtagtgagggtggtggctacgaa
catgacatcaacttcctgatgaagatggccctcgacaagatcgcctttatccccttcagc
tacctcatggaccagtggcgctggagggtctttgacggaagcatcaccaaggagaattac
aaccaagagtggtggagcctcagactgaggtaccagggtctctgtcctccattgccaaga
tctcaagatgactttgacccagggtccaagtttcacattcctgcaaatgtgccatacatc
agatacttcatcagttttatcatccagttccagttccacgaggcgctgtgccgtgcagct
gggcacacaggtcccctgcacaagtgtgacatctaccaatccaaagaagcaggaaagctg
ctggcagatactatgaagatgggctacagtaagccatggcctgaagccatgaggctgatc
acaggccagtctaacatgtcagcctccgccatgatgagctacttcaagccactgacagaa
tggctcaccactgaaaacaggagacatggagagacactgggctggccacagtacaactgg
acaccagacacggctcgctcagaaggcccctttccagagtctggtcgagtcaacttcctg
ggcatgtacctggagccacagcaggcccgtgtgggccaatgggtgctgctcttcctaggc
gtctccttgcttgtggccaccttgggtctcacccatcgactcttcagcatccgccaacat
cacagcctccaccggccccatcgtgggccccagtttgggtctgaggtggagctcagacac
tcctga

DBGET integrated database retrieval system