KEGG   Cricetulus griseus (Chinese hamster): 107977042Help
Entry
107977042         CDS       T02813                                 

Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B-like
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107977042
Enzymes [BR:cge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107977042
Chromosome [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107977042
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 468 aa AA seqDB search
MPRVPAASNSTSPKLTHMNNSRVPKKLRKPAKPLLSKIKLRNHCKRLDQKNASRKLEMGN
LVLKEPKVVLYKNLPIKKEKEPEGPEQAAVGSGCLTRHAAREHRQNPGRGAHSQGDSLPC
TYTTRRSLRTRTGLKEATDIKLEPSPLDGYKNGLLEPCPDSDQHPTPEVLEELAPETAHM
EEASQECPKSDPCPSRKKFRQGKPMKHLAKAEDCSLEHGFPGKDGLPDLPVPHPDQGEPS
GTIGVPVSYTDSAPSPVGCSIVTPDSFTTKDSFRTAQSKKKRRVTRYDAQLILENSSGIP
KLTLRRRHDSSSKTNDHESDGMNSKISIKLSKDHESDSNLYVAKLSNGVSSGPGGSSTKL
KIQLKRDEESRGPYAEGLHENGVCCSDPLSLLESQMEVDDYSQYEEDSTDDSSSSEGEEE
EEDCEDDFDDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgccaagagtcccagctgcttctaactctacctcacctaagctaacgcacatgaacaat
tccagggtaccaaagaaactaagaaagccggcaaagcctttactttccaagatcaaactg
aggaatcactgcaagcggctggaccagaagaatgcatcacggaagcttgagatgggaaac
ttagtgcttaaggagcctaaagttgtgctatataaaaatttgccaattaagaaagagaag
gagccagaggggccagagcaggctgctgtggggagtgggtgcttgacgaggcatgccgcc
agagaacacaggcagaaccctgggagaggtgctcactcgcagggggacagtttgccctgc
acctacacaacccggcgctcattgaggacaaggacaggtctgaaggaagccactgacatc
aagcttgaaccaagtcccttagatggctataaaaatggccttctggaaccttgcccagac
agtgatcagcacccaaccccagaggttctggaagaactggctccagagactgcacatatg
gaggaagcgtcccaggagtgtcccaagagtgacccatgcccatcaagaaagaaatttcgg
caagggaaacccatgaaacacttagcaaaggcagaagactgcagtctggagcatggcttc
cccgggaaagatgggctgccagatttgccagttccccatcctgaccagggtgagcccagt
ggcacgatcggggtgcctgtgagctacacagactctgctccctcacctgttggctgttcc
attgtcacacccgacagcttcacaacaaaagacagtttcagaactgcacaaagtaaaaag
aagcgtcgggtcaccaggtacgatgcacagctgatactggagaacagctctgggatcccc
aaactgacacttcgcaggcggcatgatagcagcagcaagacaaacgaccatgagagtgat
ggtatgaactcaaaaatcagcatcaagctcagcaaagaccatgaaagtgacagcaacctc
tatgtcgcaaagctaagtaatggggttagctcggggccaggcggcagctctaccaagctc
aagatccagctcaagcgggatgaggagagcagggggccatatgcagaggggcttcatgag
aatggagtgtgctgcagtgatcccctctccttgctggagtcccagatggaggtggacgac
tacagtcagtacgaggaggacagcacagatgattcatcgtcttctgagggagaagaggag
gaggaggactgcgaggacgactttgatgatgacttcatccctcttcctcccgcaaagcgg
ctgaggctaattgttggtaaagactccatagatatcgacatttcttcaaggagaagagaa
gatcagtctctaaggctgaacgcatga

DBGET integrated database retrieval system