KEGG   Corynebacterium glutamicum SCgG2: C629_02970Help
Entry
C629_02970        CDS       T02691                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgg00001]
   00640 Propanoate metabolism
    C629_02970
   00650 Butanoate metabolism
    C629_02970
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C629_02970
   00280 Valine, leucine and isoleucine degradation
    C629_02970
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C629_02970
Enzymes [BR:cgg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C629_02970
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     C629_02970
Amino acid related enzymes [BR:cgg01007]
 Aminotransferase (transaminase)
  Class III
   C629_02970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
629038..630384
Genome map
AA seq 448 aa AA seqDB search
MEDLSYRIPQSRTVAEQVPGPKSKALDERRQAAVARALAPGLPGYVVDADGGILADADGN
RFIDLASGIAVTTVGGSNAAVAKAVGAAAARFTHTCFMVSPYETYVAMAERLNALTPGDH
DKKSALFNSGAEAVENAVKVARAYTGKGAVVVFDNAYHGRTNLTMAMTAKNRPYKSGFGP
LAADVYRAPMSYPLRDGLSGPEAAERAISVIESQVGAENLACVVIEPIQGEGGFIVPAPG
FLAAISTWCRENDVVFIADEIQSGFLRTGDWFASDAEGVIPDVITTAKGIAGGMPLSAVT
GRAEIMDAPGPGALGGTYGGNPVACAAALAAIEVMEQADLKTRAQEIEAIIRDEFAQLSA
FPEVAEIRGRGAMMAIELIDATGRPNAALTAAVAARAKAEGVLLLTCGTDGNVIRLLPPL
VIAEDTLRDGLQVLVAALERETAHQKVG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatctctcataccgcatcccgcaatcgcgcaccgtggccgagcaggtgccaggg
ccgaagtcgaaagcgctggatgagcgtcgacaagcagcagtagcacgagcacttgcaccg
ggtctgcctggatacgtggtggacgcagacggtggcatcttggctgacgcggacggcaac
cgtttcatcgacctggcctccggcatcgccgtgaccacggtcggcggatccaacgcggcc
gtcgcgaaagccgtcggcgccgcagctgcccgcttcacccacacctgcttcatggtctca
ccttatgaaacttacgtggcaatggcggagagactcaacgccttgactccaggcgatcac
gacaagaagagcgcgctgtttaactctggcgccgaagccgtggaaaacgccgtcaaggtg
gcacgcgcctacaccggcaagggcgcggtcgtggtgttcgacaacgcgtaccacggacgg
accaacctcaccatggcgatgaccgcgaagaaccgcccatacaagtccggattcggacca
ctagccgcagacgtctaccgtgcaccaatgtcttacccactgcgcgacggactgtccggc
ccggaagccgcagagcgcgcgatctccgtgatcgaatcccaggtcggagccgaaaacctc
gcctgcgtggtcattgaaccgatccagggcgaaggcggattcatcgtccccgcaccagga
ttcctcgcagccatttccacctggtgccgcgagaacgacgtggtgttcatcgccgatgaa
atccaatctggcttcctgcgcaccggcgactggttcgccagcgacgcagaaggtgtgatc
cccgacgtcatcaccaccgcaaaaggcatcgccggcggcatgccactatccgcagtgacc
ggccgcgcagaaatcatggacgcacccggccccggcgcgctcggcggaacctacggcgga
aaccccgttgcttgcgccgcagcacttgcagccattgaagtgatggaacaagccgacctt
aagacccgcgctcaagaaatcgaggccatcatccgcgatgaattcgcgcagctgagtgcc
ttcccggaggtcgccgaaatccgcggccgcggagcaatgatggctattgagcttatcgac
gctaccggccgcccgaacgcagctttaaccgccgcagtggctgcgcgcgcaaaagctgaa
ggtgtgctgctgctgacttgcggcaccgatggcaacgtcatccgcctgctgccaccactg
gtcattgcagaggacactctccgtgatggtcttcaggtgttagtcgcagccctagagcgc
gaaaccgcgcaccagaaggtgggctaa

DBGET integrated database retrieval system