KEGG   Cryptococcus gattii: CGB_D1760CHelp
Entry
CGB_D1760C        CDS       T02232                                 

Definition
(RefSeq) histone deacetylase 3
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cgi  Cryptococcus gattii
Brite
Enzymes [BR:cgi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CGB_D1760C
Chromosome [BR:cgi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CGB_D1760C
   HDAC complexes
    Sin3A-HDAC complex
     CGB_D1760C
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    CGB_D1760C
  Chromatin remodeling factors
   NuRD complex
    CGB_D1760C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
D:complement(join(409290..409393,409446..409536,409588..410504,410553..410973))
Genome map
AA seq 510 aa AA seqDB search
MAPDTRFTNRSKIRVSYLWSPSLQRLSDDLPSNVGRSSMVHDLIKSLGLLDFEELKGSLS
GRGKKGDGDGESEDDDDNEGDRDEIQNEDKQEADGESQRTPVSPTELSTHAQDEKATVVL
PDPSLGTKTCLIRYHDRSYIERLLKAHTDEDPNDPTHLPSSPLSSTSSPRRAKIARTDPY
NLSHDNPVFPSLSSYISHIAAATSTACRLLATDETDWAVCWDGGRHHAKRKEAGGFCYVN
DLVLGGLLLAREGRIPLQLKEGEDVKRQRTRAPRIFYLDMDLHYSDGVSAAFHSPTVYPY
PMEEGVNPPKPPNVLTLSVHHSSPIFFPPPTPLSLLPSPGTESPFSLSIPLSAYPSRQTY
AKVFNQCIQPIREAWDPDYVILQLGTDGLPGDRVGQYGNWSVAGEGGIKWVVERVKEWGK
KVCVTGGGGYRHDNAARAWAEVMGVLLDRDFEEDMPIPHHDHFEQYAPSFTLQVPDSHMR
DENKPEDLEKAAEVFNVLAERIKVIVDANS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcaccagatacaagatttacgaatcgctctaaaatcagagtgtcatacctatggtcg
ccctctctccaacgtctatccgacgacttgccttcaaatgtcggacgttcaagtatggtg
catgatttgatcaagtcactgggcttacttgatttcgaagagctgaaggggagcttgtca
ggaagaggtaaaaaaggagatggggatggagagagtgaagatgatgacgacaatgaaggg
gacagagatgagatacaaaatgaggataagcaagaggctgatggagagtcccaaagaaca
ccagtcagccctactgagctctcaacccacgcccaagatgagaaagccacagttgttctt
ccagatccaagtctaggtaccaagacatgtcttataagataccatgatcgttcatacata
gagcgccttttaaaagcacacaccgacgaggatcctaatgaccctacccatctcccatct
tcacctttatcgtccacttcatcacctcggcgggccaagattgctcgcacggatccttac
aacctctcgcacgacaatcctgtctttccaagcttatcgtcgtacatctcccatatagca
gcggctacatccacggcgtgccgtctgcttgccactgatgaaactgactgggcggtctgc
tgggacggtggtcggcaccatgcgaaaagaaaagaggcggggggattttgttatgtgaat
gatcttgtactgggtggcttgttgctcgcccgcgaggggcgaataccattacagttgaag
gaaggggaagatgtaaagagacagcggacaagggcaccaaggatattctaccttgatatg
gacctccactactctgatggagtttcagcagccttccactctcccacagtgtacccctac
cccatggaagaaggcgtaaaccccccgaaaccacccaatgtcctgaccctttccgttcac
cattcatctcccatcttcttccctcctcctacgcccctctctctcctaccatctccaggt
actgaatctccgttctctctctccatcccactctcagcgtatccttcccgtcaaacatat
gcaaaagtgttcaaccaatgcatccagccgatccgcgaagcttgggacccagactacgtc
attctccagctcggcactgatggtcttcctggagatagggtggggcagtacggaaactgg
tctgttgcgggggaaggagggattaagtgggttgtggagcgggtgaaagaatgggggaaa
aaagtttgtgtaacgggtggaggagggtatagacatgataatgctgctagagcctgggcc
gaggtcatgggtgttctgctggatagagattttgaagaggacatgcctattccccaccat
gatcatttcgagcagtatgctccatcttttactttacaagtgccggacagccatatgaga
gacgaaaacaagccggaggatctggaaaaggctgctgaagtgttcaacgtcctcgccgag
agaatcaaagtcatcgtagacgccaattcatag

DBGET integrated database retrieval system