KEGG   Cryptococcus gattii: CGB_L1450CHelp
Entry
CGB_L1450C        CDS       T02232                                 

Definition
(RefSeq) hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
cgi  Cryptococcus gattii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGB_L1450C
   00051 Fructose and mannose metabolism
    CGB_L1450C
   00052 Galactose metabolism
    CGB_L1450C
   00500 Starch and sucrose metabolism
    CGB_L1450C
   00520 Amino sugar and nucleotide sugar metabolism
    CGB_L1450C
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CGB_L1450C
Enzymes [BR:cgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CGB_L1450C
Membrane trafficking [BR:cgi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CGB_L1450C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
L:complement(join(330925..330971,331057..331180,331247..331463,331533..331690,331743..331798,331862..331904,331978..332172,332228..332316,332372..332394,332445..332461,332517..332607,332659..332819,332878..332897,332953..332959,333010..333092,333145..333189,333247..333277,333331..333597))
Genome map
AA seq 557 aa AA seqDB search
MSETPDQLASRVQNLSTGATATHRTPSASVVLENGTNTGSTAGRKASIPAQAVGLESASA
TGSGRVSRRGSGLVMTPGGVQTVYHTRTNEDIEFPHAEKKTMADLLRKYESLFTLTPQRM
RMIVHAIEENLDNGLQKNGQVVPMLPTYVFGWPTGDEVGDFLALDLGGTNLRVCLVTLLG
RGKFEVTQTKYRLTEEQKQDDGQALLDFCAECLDSFVRDTLGRTEKDGILPLGFTFSYPC
SQERIDHGVLIRWTKGFGASNIEGYDVAAMFKDSLKRLNVPAELTALINDTTGTLIASNY
VDPHTKIAVIFGTGCNAAYMETAGSIPKIDYVGLPKEQGMAINCEWGAFDSFDHQHLPRT
KYDIIIDESSNKPGEQSFEKMIAGLYLGELFRLVVCELIDSGDLFLGQNTYKLEKAYAFD
TAFLSLMEADVTDELLTVIGVFTHFFGIETTLEERQFFKKLAVLIGTRSARLSACGIAAI
VSKMGYLEEGCAVGADGSLYNKYPNFADRVHEALSDIFGESGKKIVTHHAEDGSGVGSAI
IAAMTKARKDSGYFVEY
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaacccctgatcagctcgcaagccgcgtccagaacctcagcaccggcgccaca
gccacccacaggaccccctcggcctccgtcgttttggagaatggtaccaacactggctcc
actgccggccgcaaggcctccatacctgctcaggccgtcggtctcgagagcgccagcgcc
accggcagtggccgagtcagcaggagaggcagtggcttggtgatgactccaggaggtgtt
caaacggtgtaccacaccagaacaaatgaggatatcgaattccctcatgctgagaagaag
actatggcggaccttttgaggaagtatgaaagccttttcaccctgactccccagaggatg
aggatgatcgtccatgccattgaagaaaaccttgataacggtttgcagaagaacggtcaa
gttgtgcctatgcttcctacttatgtctttggctggcccaccggtgacgaagtcggagac
ttcctcgctctcgacctcggtggtaccaaccttcgagtctgtctcgtcactcttctaggc
cgtggaaagtttgaagtcactcagaccaagtaccgattgaccgaggaacagaagcaagac
gatggacaagctctcttggacttttgcgcagagtgtttagacagcttcgtccgcgatacc
ctcggccgcactgaaaaggacggtatcctcccgcttggtttcactttctcatacccttgc
tctcaagagcgaattgaccacggtgttcttatccgttggaccaagggctttggtgcctcg
aatattgaaggatatgatgtcgccgccatgttcaaggacagtcttaagcgattgaatgtc
cccgccgaactcactgctctcatcaatgacaccaccggtactcttatcgcctccaactat
gttgacccccacaccaagattgccgtcatctttggaaccggctgcaacgctgcctacatg
gagaccgccggcagcatcccaaagatcgactacgtcggattacccaaggaacagggaatg
gccatcaactgtgaatggggagcgttcgactctttcgaccaccaacaccttccccgaacc
aagtacgatatcatcatagacgagtcttccaacaagccaggagagcagtcctttgagaag
atgattgccggcctttacctcggtgaactcttccgactcgtcgtttgcgagctcatcgac
tctggtgatcttttcttgggtcagaacacctacaagctcgaaaaggcctatgctttcgac
accgctttcttatccctcatggaagccgatgttaccgacgaacttttgaccgtcatcggc
gttttcactcacttctttggcattgaaactacccttgaagagcgtcagttctttaagaaa
cttgctgtcttgatcggtactcgatctgctagactttctgcttgtggtatcgccgccatt
gtcagcaaaatggggtacctcgaggaaggatgcgccgtcggcgccgatggaagtttgtac
aacaaataccccaactttgcggaccgagttcatgaggcccttagtgacatttttggtgaa
agcggcaagaagattgtcacccaccatgcggaggatggttcaggtgtcggtagtgcaatt
attgccgcaatgacaaaggccagaaaagactctgggtactttgttgaatactaa

DBGET integrated database retrieval system