KEGG   Corynebacterium glutamicum ATCC 21831: AR0_13585Help
Entry
AR0_13585         CDS       T03361                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cgj  Corynebacterium glutamicum ATCC 21831
Pathway
cgj00010  Glycolysis / Gluconeogenesis
cgj00071  Fatty acid degradation
cgj00350  Tyrosine metabolism
cgj00625  Chloroalkane and chloroalkene degradation
cgj00626  Naphthalene degradation
cgj01100  Metabolic pathways
cgj01110  Biosynthesis of secondary metabolites
cgj01120  Microbial metabolism in diverse environments
cgj01130  Biosynthesis of antibiotics
cgj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cgj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AR0_13585
  Lipid metabolism
   00071 Fatty acid degradation
    AR0_13585
  Amino acid metabolism
   00350 Tyrosine metabolism
    AR0_13585
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AR0_13585
   00626 Naphthalene degradation
    AR0_13585
Enzymes [BR:cgj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AR0_13585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 adh_short TrkA_N UDPG_MGDP_dh_N 3HCDH_N ThiF
Motif
Other DBs
NCBI-ProteinID: AIK88985
LinkDB All DBs
Position
complement(2868879..2869916)
Genome map
AA seq 345 aa AA seqDB search
MTTAAPQEFTAAVVEKFGHDVTVKDIDLPKPGPHQALVKVLTSGICHTDLHALEGDWPVK
PESPFVPGHEGVGEVVELGPGEHDVKVGDIVGNAWLWSACGTCEYCITGRETQCNEAEYG
GYTQNGSFGQYMLVDTRYAARIPDGVDYLEAAPILCAGVTVYKALKVSETRPGQFMVVSG
VGGLGHIAVQYAAAMGMRVIAVDIADDKLELARKHGAEFTVNARNEDPGEAVQKYTNGGA
HGVLVTAVHEAAFGQALDMARRAGTIVFNGLPPGEFPASVFNIVFKGLTIRGSLVGTRQD
LAEALDFFARGLIKPTVSECSLDEVNGVLDRMRNGKIDGRVAIRF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgctgcaccccaagaatttaccgctgctgttgttgaaaaattcggtcatgac
gtgaccgtgaaggatattgaccttccaaagccagggccacaccaggcattggtgaaggta
ctcacctccggcatctgccacaccgacctccacgccttggagggcgattggccagtaaag
ccggaatcaccattcgtaccaggacacgaaggtgtaggtgaagttgttgagctcggacca
ggtgaacacgatgtgaaggtcggcgatattgtcggcaatgcatggctctggtcagcgtgt
ggcacctgcgaatactgcatcaccggcagggaaactcagtgcaacgaagctgagtatggt
ggctacacccaaaatggatccttcggccagtacatgctggtggatacccgttacgccgct
cgcatcccagacggcgtggactacctcgaagcagcaccaattctgtgtgcaggcgtgact
gtctacaaggcactcaaagtctctgaaacccgcccgggccaattcatggtggtctccggt
gtcggcggacttggccacatcgcagtccaatacgcagcggcgatgggcatgcgtgtcatt
gcggtagatattgccgatgacaagctggaacttgcccgtaagcacggtgcggaatttacc
gtgaatgcgcgtaatgaagatccaggcgaagctgtacagaagtacaccaacggtggcgca
cacggcgtgcttgtgactgcagttcacgaggcagcattcggccaggcactggatatggct
cgacgtgcaggaacaattgtgttcaacggtctgccaccgggagagttcccagcatccgtg
ttcaacatcgtattcaagggcctgaccatccgtggatccctcgtgggaacccgccaagac
ttggccgaagcgctcgatttctttgcacgcggactaatcaagccaaccgtgagtgagtgc
tccctcgatgaggtcaatggtgtgcttgaccgcatgcgaaacggcaagatcgatggtcgt
gtggcgattcgtttctaa

DBGET integrated database retrieval system