KEGG   Chryseobacterium gallinarum: OK18_15490Help
Entry
OK18_15490        CDS       T03954                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cgn  Chryseobacterium gallinarum
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cgn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OK18_15490
  Energy metabolism
   00680 Methane metabolism
    OK18_15490
Enzymes [BR:cgn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OK18_15490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3434835..3437369
Genome map
AA seq 844 aa AA seqDB search
MIHDQRAEKFRQIVENKFQIYNSLFMSLPYDKMTNIGMLLPFLYEESRTGYEAGKTPEII
VEEFFKNHTDLETEEQKLELLFKIIQYIERQVVLFDSIEDAAFPNLHSESDNGTVTNLFE
RSFQDHKLEKVREKLKDFSVKVVFTAHPTQFYPSSVQRIIQDLRGAITSDSVTQIDMLLQ
QLGKTPFVNKEKPTPIDEALSIISYLRYVYYDTIGELFTKIKKTFGNGHFHLHEDIIQLG
FWPGGDRDGNPFVTADVTKRVAEELRSAILKSYYSHLKFIRRRLSFRGVSEILTQLSEEL
YAAIFNGKSITAEDILAKADEAENILIHEHNSLFLDLLTNFRDRVRIFGTHFATLDIRQD
SRIHQKAIDEVFARLYGNEEADPQQKFTRLIQVSEKINPDDFEDIVKDTLLTVSQVSEIQ
NVNGLRGMNRYIISNSDAVKDVMNVYAFFKVCGYKDEEINMDIVPLFETMEGLANAENVM
NELYQNPVYKKHIERRGNQQTIMLGFSDGTKDGGYLKANWEIYKAKELLTKLSEQHHIKV
IFFDGRGGPPARGGGKTHDFYASQGKTIANNKIELTIQGQTITSIFGNKEQAKYNFEQLL
TAGVENDVFKNAKKELTEKERKLIAELAEISYKKYADLKAHPMFVPYLQEMSTLEYYGKT
NIGSRPSKRGNGSELKFEDLRAIPFVGSWSQLKQNVPGFFGFGYAMQQMKEQGRFEEVRE
LYKGSDFFKTLVLNSMMSMNKSYFPLTYYIKNNPKFGTFWNILFDEYELSKDIMLELTGF
KMLQEEDPLSRKSVKIREKIVLPLLSIQQYALMKIQKGEGDKGAYEKLVTRSLFGNINAS
RNSA
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgatacacgaccaacgcgcagaaaaattcaggcagattgtggaaaataagttccagatc
tacaattcattatttatgagcctgccatatgataaaatgaccaatatcgggatgttgctt
cccttcctttatgaggaaagcagaaccggctatgaagcaggaaaaactcccgagattatt
gtagaagaattttttaaaaatcatacagaccttgagactgaggagcaaaagctcgaactg
ctttttaagatcattcaatatatagaaagacaggtggtcttgtttgacagtattgaggat
gcagcatttcccaaccttcactccgaaagcgataacggaacagtcaccaatctttttgaa
cgttcttttcaggaccataagcttgaaaaagtgcgcgaaaagctgaaggactttagtgta
aaagttgtattcacagctcaccctacacaattttatccgagttcagtacaacgtattatc
caggacctgaggggagccattaccagtgattccgttacccagatcgatatgcttttacaa
cagttgggaaaaacaccttttgtgaacaaagagaaacccacaccgattgacgaagcactg
agcattatttcgtatttgagatacgtgtactatgataccatcggagaattatttacaaaa
attaaaaaaacgtttggaaacggacattttcatttacacgaagacatcatccagcttggt
ttctggccgggtggtgacagggatggaaaccctttcgtaacagcagatgttaccaaaaga
gtggcagaagaacttcgttctgccattctgaagtcctattacagtcatttaaagtttatc
aggagaaggctgagtttcaggggagtttcagagatcctgactcaattgagtgaagaattg
tatgctgctattttcaatggaaaaagcattactgcagaagatattttagcaaaagcagat
gaagctgaaaatatattaattcatgaacacaattctttgtttcttgatcttttgaccaat
ttcagggaccgggtgagaattttcgggactcattttgcaacgctggatatccggcaggac
agccggattcatcagaaagcaattgatgaagtatttgccagactttacggaaatgaggaa
gctgacccgcaacagaaatttacccgactgattcaggtttctgaaaaaataaatcccgat
gattttgaggatattgtaaaagatacactgctgacagtttcccaggtttctgaaattcag
aatgtaaatggtctcagaggaatgaaccgttatatcatttccaattctgatgctgtaaaa
gatgttatgaatgtatatgcattcttcaaagtttgcggatataaagacgaagagatcaat
atggatatcgttcccctttttgaaaccatggaaggccttgccaatgccgaaaatgtaatg
aatgaactatatcagaatcctgtatataaaaaacatattgaaagaagagggaatcagcag
actattatgcttggtttttctgatggaaccaaagatggaggatatttaaaagctaactgg
gaaatttataaggcaaaagaacttttaacaaaactttctgaacagcatcatatcaaagtc
attttctttgacggaagaggaggtcctcctgcaaggggtggaggaaaaacccacgatttt
tacgcatcacaaggtaaaaccattgccaataataaaattgaattaacaattcaggggcag
actattaccagtattttcggaaataaagaacaggctaagtataattttgaacagctttta
acagcaggagttgaaaatgatgtctttaaaaatgctaaaaaagaacttacggaaaaagaa
agaaaactgattgctgaactggcggaaatcagctacaaaaaatacgcagatctgaaagcc
caccctatgtttgttccctatcttcaggaaatgagtacactggaatactatggaaaaaca
aatatcggaagccgtccttccaaaagaggaaacggaagtgaactgaagtttgaagatttg
agagccattccatttgtgggatcatggtcccagctgaagcaaaatgtgccgggattcttc
ggctttggatatgccatgcagcaaatgaaagagcagggaagatttgaagaagtaagagaa
ttatacaaaggttcggacttttttaaaacattggttctaaactccatgatgagtatgaac
aaatcttattttcccttgacatattatatcaaaaacaatccgaaattcggcacattctgg
aatatcctttttgatgaatacgaactttcaaaagatattatgcttgagctgaccggattt
aaaatgcttcaggaagaagatccgctatccagaaaatcagtaaaaatccgtgaaaaaatt
gttcttccgttattgagtattcaacaatacgccttgatgaagattcaaaaaggagaagga
gataaaggcgcctatgaaaagctggtgacgcgttctttattcggaaatattaatgccagc
agaaactcagcgtaa

DBGET integrated database retrieval system