KEGG   Coriobacterium glomerans: Corgl_0199Help
Entry
Corgl_0199        CDS       T01453                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cgo  Coriobacterium glomerans
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cgo00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Corgl_0199
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Corgl_0199
Enzymes [BR:cgo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Corgl_0199
Peptidoglycan biosynthesis and degradation proteins [BR:cgo01011]
 Precursor biosynthesis
  Racemase
   Corgl_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
233178..234329
Genome map
AA seq 383 aa AA seqDB search
MVPAGGPATRWAWVEIDRGAMLRNTRAFKKMLKPRQRLCCVLKADAYGHGAVESSKIMRS
AGADMFAVATVAEGIELRRGGCSAPVLVLGEPPCDAIPELLENDLMPAVYTSEFALAFGE
CAVQVDKVGKYHLAIETGMNRIGVHYTKVVSFRRGIEFHRGIQCDGVFTHFATADDPCGW
DYKLQCTRFDEAVQAMRDAGFECGIVHCDNTPASILDPESHHDMIRVGIGLYGLQPADAT
RERIRLDPVMSVRARVMRVAYPSMGEGVGYGFTYRVPRATVQICTLPIGYADGLARTLSN
RMDVLYRGGRIRQVGNICMDQTMVAIQQTPAEPIPEAEYGDLMTIVGRDGDAEVSMDEMA
RLRNTINYEVACDFGMRLEKIYI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctgcgggagggccggcgactcgctgggcgtgggtcgagatagaccgcggtgcg
atgcttcgcaatacgagagcgttcaagaagatgctcaagccgcggcagcgcctgtgctgc
gttctcaaggcggatgcctacggtcacggtgccgttgaatcatcgaagatcatgagatcg
gcgggtgccgacatgttcgctgtcgcgacggtggccgagggaatcgagcttcgtcgagga
ggatgctccgctcccgttctcgtgctgggtgagccgccgtgcgatgcgattcccgagttg
ctggagaacgatctgatgccagctgtctacacctcggaattcgcgctggcatttggagag
tgcgcggttcaggtagacaaagtcggaaagtatcatcttgcgatcgagacgggtatgaac
cgcatcggtgttcactataccaaggtggtttcattccgaagagggatcgagttccatcgg
ggcatccaatgcgacggggtcttcacgcatttcgcgacggcggatgatccttgcgggtgg
gactacaagctccagtgcacgcgctttgacgaggcggttcaagcaatgcgcgacgcgggc
ttcgaatgcggcatcgtgcactgcgacaacactcccgcttctattctggatccagagtcg
catcacgatatgattcgcgtgggaatcggactctatggtttgcagccggctgatgccacc
cgcgagcgcataaggctcgatcccgtcatgagcgttcgcgctcgagtcatgcgcgtggcg
tatccctcgatgggagaaggtgtcggatacggcttcacctatcgagtcccccgggcgacc
gttcagatctgcacgctgccgatcggatacgctgacgggctcgcgcgcacgctatcgaat
cgcatggatgtgctttaccgcggaggccgtatcagacaggtcggcaacatctgcatggat
cagacgatggtcgccattcagcagacgccggccgaaccgattccggaggcggagtacggc
gatctcatgacgatcgtcggcagggatggcgatgccgaggtgtccatggatgagatggcg
cggttgcgcaacacgatcaactacgaggtcgcgtgtgatttcggcatgcggctcgaaaag
atctacatctaa

DBGET integrated database retrieval system