KEGG   Corynebacterium glutamicum SCgG1: C624_09225Help
Entry
C624_09225        CDS       T02690                                 

Definition
(GenBank) hypothetical protein
  KO
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
cgs  Corynebacterium glutamicum SCgG1
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C624_09225
   00520 Amino sugar and nucleotide sugar metabolism
    C624_09225
Enzymes [BR:cgs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     C624_09225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1986895..1987647
Genome map
AA seq 250 aa AA seqDB search
MTETGFGIDIGGSGIKGARVNLKTGEFIDERIKIATPKPATPEAVAEVVAEIISQAEWEG
PVGITLPSVVRGQIALSAANIDKSWIGTDVHELFDRHLNGREITVLNDADAAGIAEATFG
NAAAREGAVILLTLGTGIGSAFLVDGQLFPNTELGHMIVDGEEAEHLAAAAVKENEDLSW
KKWAKRLNKVLSEYEKLFSPSVFIIGGGISRKHEKWLPLLELDTDIVPAELRNRAGIVGA
AMAVNQHLTP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactgagactggatttggaattgatatcggtggctccggcatcaaaggcgcccgcgtt
aaccttaagaccggtgagtttattgatgaacgcataaaaatcgccacccctaagccagca
accccagaggctgtcgccgaagtagtcgcagagattatttctcaagccgaatgggagggt
ccggtcggaattaccctgccgtctgtcgttcgcgggcagatcgcgctatccgcagccaac
attgacaagtcctggatcggcaccgatgtgcacgaactttttgaccgccacctaaatggc
cgagagatcaccgttctcaatgacgcagacgccgccggcatcgccgaagcaacctttggc
aacgctgccgcacgcgaaggcgcagtcatcctgctgacccttggtacaggtattggatcc
gcattccttgtggatggccaactgttccccaacacagaactcggtcacatgatcgttgac
ggcgaggaagcagaacaccttgcagcagcagccgtcaaagaaaacgaagatctgtcatgg
aagaaatgggcgaagcgcctgaacaaggtgctgagcgaatacgagaaacttttctcccca
tccgtcttcatcatcggtggcggaatttccagaaagcacgaaaagtggcttccattgctg
gagctagacactgacattgtcccagctgagctgcgcaatcgagccggaatcgtaggagct
gccatggcagtaaaccaacacctcaccccataa

DBGET integrated database retrieval system