KEGG   Corynebacterium glutamicum B253: SB89_08680Help
Entry
SB89_08680        CDS       T03668                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cgx  Corynebacterium glutamicum B253
Pathway
cgx00010  Glycolysis / Gluconeogenesis
cgx00520  Amino sugar and nucleotide sugar metabolism
cgx01100  Metabolic pathways
cgx01110  Biosynthesis of secondary metabolites
cgx01120  Microbial metabolism in diverse environments
cgx01130  Biosynthesis of antibiotics
cgx01200  Carbon metabolism
Module
cgx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SB89_08680
   00520 Amino sugar and nucleotide sugar metabolism
    SB89_08680
Enzymes [BR:cgx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     SB89_08680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AJE67607
LinkDB All DBs
Position
1852120..1852872
Genome map
AA seq 250 aa AA seqDB search
MTETGFGIDIGGSGIKGARVNLKTGEFIDERIKIATPKPATPEAVAEVVAEIISQAEWEG
PVGITLPSVVRGQIALSAANIDKSWIGTDVHELFDRHLNGREITVLNDADAAGIAEATFG
NPAAREGAVILLTLGTGIGSAFLVDGQLFPNTELGHMIVDGEEAEHLAAASVKENEDLSW
KKWAKHLNKVLSEYEKLFSPSVFIIGGGISRKHEKWLPLLELDTDIVPAELRNRAGIVGA
AMAVNQHLTP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactgagactggatttggaattgatatcggtggctccggcatcaaaggcgcccgcgtt
aaccttaagaccggtgagtttattgatgaacgcataaaaatcgccaccccgaagccagca
accccagaggctgtcgccgaagtagtcgcagagattatttctcaagccgaatgggagggt
ccggtcggaattaccctgccgtctgtcgttcgcgggcagatcgcgctatccgcagccaac
attgacaagtcctggatcggcaccgatgtgcacgaactttttgaccgccacctaaatggc
cgagagatcaccgttctcaatgacgcagacgccgccggcatcgccgaagcaacctttggc
aaccctgccgcacgcgaaggcgcagtcatcctgctgacccttggtacaggtattggatcc
gcattccttgtggatggccaactgttccccaacacagaactcggtcacatgatcgttgac
ggcgaggaagcagaacaccttgcagcagcatccgtcaaagaaaacgaagatctgtcatgg
aagaaatgggcgaagcacctgaacaaggtgctgagcgaatacgagaaacttttctcccca
tccgtcttcatcatcggtggcggaatttccagaaagcacgaaaagtggcttccattgctg
gaactagacactgacattgtcccagctgagctgcgcaatcgagccggaatcgtaggcgct
gccatggcagtaaaccaacacctcaccccataa

DBGET integrated database retrieval system