KEGG   Chelatococcus sp. CO-6: AL346_14620Help
Entry
AL346_14620       CDS       T04040                                 

Definition
(GenBank) ABC transporter permease
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
chel  Chelatococcus sp. CO-6
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:chel00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    AL346_14620
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AL346_14620
Transporters [BR:chel02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    AL346_14620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3085652..3086548
Genome map
AA seq 298 aa AA seqDB search
MTLPSIKGDAIAAFPAERQKATVVTLPPAVSRRFDITALATRLAQSIVPPLVVLLVLLAV
WQVAFSGPGSSLPPPSEIWNESSDLILDPFFVNGTQDIGLGWRVIVSLERVAIGFGLAAV
AGVLLGALVGQSVWMMRGLDPIFQVLRTVPPLAWLPISLAAFMDSRPSAIFVIFITAIWP
VIINTAAGVRNIPEDYRNVARVLRLNQVEFFFKIMVPAAAPYIFSGLRIGVGLSWLAIVA
AEMLTGGVGVGFFIWDAWNSSRLTDIIVALVYIGLVGFLLDRLVGFVGVIVTRGAAAS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacattgccgtccatcaagggcgatgcgatcgccgcattccccgccgagcgccagaag
gcgacggtggtgacgcttccgcccgccgtgtcccgcaggttcgatatcaccgctcttgcc
acgcggctcgcacaatccatcgtcccgccgctcgtcgttctcctcgttctccttgccgtg
tggcaggtggccttctcgggccccgggtcgtcgctgccgccgccgagcgagatctggaac
gagagcagcgacctgatcctcgacccgttcttcgtcaacggcacgcaggacatcggcctc
ggctggcgcgtcatcgtctcgctggagcgggtcgccatcggcttcggcctcgccgcggtg
gcgggcgtgctgctcggcgcgctcgtgggccagtcggtgtggatgatgcgcgggctcgat
ccgatcttccaggttctgcgcacggtgccgccgctcgcctggctgccgatctcgctcgcc
gccttcatggattcgcggccgtcggcgatcttcgtcatcttcatcacggcgatctggccg
gtgatcatcaacaccgccgccggcgtgcgcaacatccccgaggactaccgcaacgtcgcg
cgcgtgctgcgcctcaaccaggtggagttcttcttcaagatcatggtgccggcggccgcg
ccctacatcttttcggggctccggatcggcgtcggcctctcctggctcgccatcgtcgcg
gccgagatgctgacgggcggcgtcggcgtcggcttcttcatctgggatgcgtggaactcc
tcgcgcctcaccgacatcatcgtggcgctcgtctacatcggcctcgtcggcttcctgctc
gaccggctggtcggcttcgtcggcgtcatcgtcacccgcggcgccgcggccagctga

DBGET integrated database retrieval system