KEGG   Capnocytophaga haemolytica: AXF12_09400Help
Entry
AXF12_09400       CDS       T04287                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
chg  Capnocytophaga haemolytica
Pathway
chg00052  Galactose metabolism
chg00511  Other glycan degradation
chg00600  Sphingolipid metabolism
chg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AXF12_09400
  Lipid metabolism
   00600 Sphingolipid metabolism
    AXF12_09400
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AXF12_09400
Enzymes [BR:chg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AXF12_09400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4982 Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Glyco_hydro_42 Imm72 Cellulase
Motif
Other DBs
NCBI-ProteinID: AMD85708
UniProt: A0A0X8JC34
LinkDB All DBs
Position
complement(2089940..2092447)
Genome map
AA seq 835 aa AA seqDB search
MKRLLTTVLLGAALCGFAQSEQTLEKGWRFTREDKADFAAATFDDSSWQSVTVPHDWAIY
GPFDIENDVQRTAIKQDGQVAPIAHSGRTGGLPFVGVGWYRTHFKVDDFEAGSGKSVFVQ
FDGAMSNPVVYVNGQRAGEWHNGYNTFFLEITPFIKQGDNTLAVRLENLTQQSRWYPGAG
LYRNVHIIVKNDTYVPIWGVQITTPEVNKEFAKVKVKTEVELTPSFVTNPKNIKNTPIKV
RTEIYAPDGKRIVSGEKSLDEYSIEGVEQELIVDKPALWDVGKPNLYKAVSIILEEDKVR
DRVTTTFGIRSIELRPNDGLYLNGRKIQFKGVCLHHDLGPLGAAVNEAAIRRQIKIMQDM
GANAIRTSHNMPAPEYVRIANEMGMMLAVESFDEWAIPKVDNGYHLYFKDWAKEDLRNLV
KHYRNDPSVVLWFIGNEVEEQSVESGSQVARYLQDIVKKYDTTRPVCNGMDRPDDVMKNN
MAATMQVAGFNYRPFKYEEAYKRLPQQLLLGSETASTLSSRGVYKFPVERKSMPKYDDQQ
TSSYDVEHCGWSNLPEDDWVHQDDLPYMLGEFVWTGFDYLGEPTPYYVEWPAHSSYFGAV
DLAGLPKDRFYLYRSRWNKDKETLHILPHWNWEGREGETTPVFVYSNYPMVELFINGKSQ
GKRSKDTNVKIAGSDSEAAKKSFERQKRYRLMWMDTKYKPGTVKAVAYDEKGKKVATTEI
HTAGKPYALRLTADRTQLKADGKDLAFITVEVVDKKGNVCPTPKDLVHFEVSGAGTYRAG
ANGDATCTDVFHLPQMHLFSGKAVAIVQAAEQAGKVVLKAKSEGLKSAEIVMNVQ
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaagagattattaaccacagtactattaggggcggctctgtgtggctttgcccagagt
gagcagactcttgaaaagggttggcgttttacacgtgaggataaggcagactttgctgct
gcgacatttgacgacagtagttggcagagcgtaacagtgccccacgattgggctatttat
ggtccgtttgatattgagaacgatgtgcagcgtacggctatcaagcaagatgggcaggtg
gctccgattgcgcattcggggcgtacggggggcttgccttttgtaggggtaggctggtat
cgcacgcactttaaggtagacgactttgaggcgggctcgggtaagagtgtatttgtacag
tttgacggggctatgagcaaccccgtggtatacgtcaatgggcagagggctggcgagtgg
cataatggctacaatactttctttttggagattaccccttttataaagcaaggtgataat
acgctggcggtacgcttggagaatctcacccaacaatcgcgttggtaccctggtgcaggg
ctttaccgcaatgtgcatatcatcgtaaagaacgatacctatgtaccgatatggggggtg
cagattactacccctgaggttaataaagagtttgctaaggtgaaggtaaagacggaggtg
gaacttacgccttcttttgtaaccaatccaaaaaatataaagaatacgcctataaaggtt
cgcactgagatttatgcccccgatgggaagcggatagtctctggggagaaatcccttgat
gagtatagcatagagggcgtagagcaagagcttatagtcgataagcctgcgctttgggat
gttggtaagcctaacctctacaaggcagtgagcattatccttgaagaggataaggtgagg
gatagggttaccactacttttgggatacgttccattgagctaagacctaatgatgggttg
tatctcaatgggcgaaagatacagtttaagggggtgtgtttgcaccacgatttgggtccg
ctgggggcagcggtaaacgaggctgcaatacgccggcagataaagataatgcaggatatg
ggggcaaatgccatacgcacctcgcacaatatgcctgcccctgagtatgtacgcattgcc
aacgagatgggtatgatgcttgctgtggagagctttgacgagtgggcaatccctaaggtg
gataatggctatcacttgtactttaaggattgggcaaaggaagacctgagaaacctcgta
aagcactaccgtaatgacccctcagtggtgctatggtttattggcaatgaggtagaggag
cagagcgtagaaagcggctcgcaggtggcgcgctacttgcaggatattgttaaaaagtat
gacactacgcgccctgtgtgcaatggtatggacagacctgatgatgtgatgaagaacaat
atggcagctacgatgcaggtagcaggctttaactatcgtccgtttaagtatgaagaggcg
tataagcgtttgccacagcagttgcttttgggcagcgagaccgcctcaacactgagttcg
cgcggggtgtataagtttcctgtggagcgcaagtcgatgccgaagtatgacgaccagcag
accagctcgtacgatgtagagcactgcggttggtcgaacctacccgaagacgactgggtg
caccaagatgacctcccctatatgttgggtgaatttgtgtggacaggctttgactacctc
ggcgagcctacgccttactatgtggagtggccagcacatagctcttattttggtgcggtg
gacttagcagggctgcccaaagaccgcttctatctataccgctcgcgttggaataaggac
aaggagacgttgcatatccttccacattggaattgggaaggacgcgagggcgagactacc
cctgtgtttgtatacagcaattaccctatggtagagctgtttatcaacggcaaaagtcaa
ggcaagcgcagcaaggatacgaatgtgaagatagcaggcagcgacagcgaagcggctaaa
aagagctttgagcgacagaagcgttatcgcctgatgtggatggatacgaaatataagcca
ggtaccgtaaaagcagtagcttatgacgagaaaggcaagaaggtagccactacggagata
cataccgcaggcaagccttatgcgctgcgccttaccgccgatagaacgcaactaaaagct
gatggtaaggatttggcgtttatcactgtggaggtggtggataagaaaggcaatgtgtgt
ccaacccctaaggatttagtacattttgaggtaagcggggcaggtacttaccgcgcgggg
gctaatggcgatgctacctgtacggatgtgttccatctgccacagatgcacctttttagc
ggtaaagccgtagcgatagtgcaggcagctgagcaggcaggtaaggtagtgctcaaagcc
aagtcagaagggctaaaaagtgcggagatagtgatgaatgtacaataa

DBGET integrated database retrieval system