KEGG   Capnocytophaga haemolytica: AXF12_10070Help
Entry
AXF12_10070       CDS       T04287                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
chg  Capnocytophaga haemolytica
Pathway
chg00240  Pyrimidine metabolism
chg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AXF12_10070
Enzymes [BR:chg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AXF12_10070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AMD85825
UniProt: A0A0X8JBG8
LinkDB All DBs
Position
2256135..2256722
Genome map
AA seq 195 aa AA seqDB search
MFLENTIHHTGEHFGWIEVICGSMFSGKTEELIRRLRRAQFAKQKVEIFKPSFDTRYDDT
NIVSHNANEIPSTPVEAATQILLLADGCDVVGIDEAQFFDDEIVNVCNDLANRGVRVIVA
GLDMDYKGKPFGPMPNLMAIAEYVTKVHAICTHTGNLAHYSYRKVANDSQRLLGEQESYE
PLSRAAFYKAMKDKR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagagaatacaatccatcatacgggcgagcattttggctggatagaggtgatc
tgtgggtcaatgttttcgggtaagaccgaggagctgatccgcaggctgcgtcgtgcgcaa
tttgcgaaacaaaaggttgagatctttaagccgagtttcgatacgcgttatgacgataca
aatatcgtttcgcacaatgctaacgagatcccttcaacccctgtggaagcagctacccag
atattacttttggcagacggctgcgatgtggtgggcatcgacgaggcgcagttctttgat
gatgagattgtgaatgtgtgcaatgacctcgccaaccgcggcgtacgggtgattgtggca
ggcttggatatggactacaaaggcaagccttttggaccgatgcctaacttgatggctatc
gctgagtatgttaccaaggtgcacgcaatatgcactcacacgggcaacttagcccattac
agctatcgcaaagtggcaaatgacagccagcgactgctcggcgagcaagagagttatgaa
ccgctgagtagggctgccttctataaagcgatgaaagacaaaagataa

DBGET integrated database retrieval system