KEGG   Corynebacterium humireducens: B842_07020Help
Entry
B842_07020        CDS       T03576                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
chm  Corynebacterium humireducens
Pathway
chm00620  Pyruvate metabolism
chm00680  Methane metabolism
chm01100  Metabolic pathways
chm01120  Microbial metabolism in diverse environments
chm01200  Carbon metabolism
Module
chm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:chm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B842_07020
  Energy metabolism
   00680 Methane metabolism
    B842_07020
Enzymes [BR:chm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B842_07020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJE33253
UniProt: A0A0B5DAP7
LinkDB All DBs
Position
complement(1428883..1431654)
Genome map
AA seq 923 aa AA seqDB search
MTVRDHLQEDIRYLGRILGQVIAEQEGEDVFNLVEHARQQAFEVAKGNASLEVLVDLFRN
IEPERATPVIRAFSHFALMANLAEDIHDDFHRERILDEGGAPDSTLNATWEKFREAGVSA
ADIERSLSAGLVAPVLTAHPTETRRRTVFDAQKHITELMLQRHAVQDAEPNARTEDRLAE
IERNIRRRMTILWQTALIRQARPRIEDEIEVGLRYYTLSLLREIPALNRHVVDTLTERFG
ADLRNSAGQAIVRPGSWIGGDHDGNPFVTADTLDYASRRAAQTVLKYYVTQLHALEHELS
LSDRMTSVTVELVALAGRGKNDVPSRVDEPYRRAVHGVRGRILATTAALIGEDAVEGVWH
REHEPYGSPQEFEADLRVIDTSLRASHDEIIADDRLSSIRAAVASFGFHLYSIDLRQNSE
SFENVLTEVFATAHVHPNYDTLREEVKIELLTRELQTPRPLVPRGYRGFSEPTQRELDLI
SQAADSVARFGEQMIPHQIISMAQSVSDILEPMVLLKEVGLIQANGQGPTGSVDIIPLFE
TIDDLQAGAGILRELWDLPIYRAYLAQRGDIQEVMLGYSDSNKDGGYFAANWALYDAETD
LVKVGREYGVRLRLFHGRGGTVGRGGGPSYDALLAQPQGAVDGSVRITEQGEIISAKYGS
PRTARRNLEALVSATLEASLLTVDDLADRARATQIMSELAQISRRKYSELVHEDPGFIPY
FTQSTPLDEIGSLNIGSRPTARKQTKGVDDLRAIPWVLAWSQSRVLLPGWFGVGTALAEW
IGEGEDRDERIAELRELYESWPFFTSIMSNMAQVMSKAGMDLAELYARLIDDREVAERVH
GVITEEFELTREMFSTVTGSAELLADNPALARSVRRRFPYLLPLNIIQLELLRRHRAGDS
RRAVSRGIQLTMNGLATALRNSG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccgcgatcatctgcaggaagacatccgctacctcggccgtatcctcggccag
gtcatcgcggaacaggagggcgaggacgtgttcaacctcgtcgagcacgcccgccagcag
gccttcgaggtggccaagggcaacgcctccctggaggtgctcgtcgacctgttccggaac
atcgagccggagcgcgcgaccccggtgatccgggcgttcagccacttcgccctgatggcg
aacctcgcggaggacatccacgacgacttccaccgggagcgcatcctcgatgagggcggg
gcccccgactccaccctcaacgccacgtgggagaagttccgggaggccggcgtcagtgcc
gcggacatcgagaggtcgctgtctgccgggctcgtcgccccggtgctcaccgcccacccg
acggagacccgccgccgcaccgtcttcgacgcccagaagcacatcaccgagctcatgctg
cagcggcacgccgtccaggacgcggagccgaacgcccgcaccgaggaccgtctcgcggag
atcgagcgcaacatccgccgccgcatgaccatcctgtggcagaccgcgctcatccggcag
gcccgcccccgcatcgaggacgagatcgaggtcggcctgcgctactacacgctctccctg
ctccgggagatcccggcgctcaaccggcacgtcgtcgacacgctcacggagcgtttcggc
gccgacctgcgcaacagcgccggtcaggccatcgtccgcccgggctcctggatcggcggc
gaccacgacggcaaccccttcgtcaccgccgacacactggactacgcttcccgacgcgcc
gcccagaccgtcctcaagtactacgtcacgcagctccacgccctcgagcacgagctgagc
ctctccgaccgcatgacctccgtcaccgtggagctcgtcgccctcgccgggcggggaaag
aacgacgtcccctcgcgtgtcgacgagccctaccgccgcgccgtccacggcgtccggggc
cgcatcctcgccacgaccgcggcgctcatcggggaggacgccgtcgagggcgtctggcac
cgcgagcatgagccctacggctccccgcaggagttcgaggcggacctcagggtcatcgac
acctcgctgcgtgcctcccacgacgagatcatcgccgacgaccgtctcagctccatccgg
gcggccgtcgcctccttcgggttccacctgtactcgatcgacctgcgacagaactccgag
tccttcgagaacgtcctcaccgaggtcttcgccaccgcgcacgtccaccccaactacgac
acgctgcgggaggaggtgaagatcgagctgctcacccgcgaactgcagaccccgcgcccc
ctcgtcccgcgcggctaccggggcttctccgagccgacccagcgggagctcgacctcatc
tcccaggccgcggactccgtcgcccgcttcggcgagcagatgatcccgcaccagatcatc
tccatggcgcagtcggtcagcgacatcctcgagccgatggtgctgctcaaggaggtcggc
ctcatccaggccaacggccagggcccgaccggcagcgtcgacatcatcccgctgttcgag
acgatcgacgacctccaggccggcgccggcatcctccgtgagctgtgggacctgccgatc
taccgggcgtacctcgcccagcgcggcgacatccaggaggtcatgctcggctactcggac
tccaacaaggacggcggctacttcgccgccaactgggcgctctacgacgccgagaccgac
ctggtgaaggtcggccgcgagtacggtgtgcgcctgcgactcttccacggccgcggcggc
accgtcggccgtggtggcggcccctcctacgacgcgctcctcgcccagccgcagggggcg
gtcgacggttccgtgcgcatcaccgagcagggcgagatcatctcggccaagtacggctcc
ccgcgtacggcccgccgcaacctggaggcactggtctccgcgacgctcgaggccagcctg
ctcaccgtcgacgacctcgccgaccgggcccgcgcgacgcagataatgagcgaactcgcg
cagatctcccgccgcaagtactccgagctcgtccacgaggacccggggttcatcccgtac
ttcacccagtcgaccccgctcgacgagatcggctccctcaacatcggctcccgcccgacc
gcccgcaagcagaccaagggcgtcgacgatctccgcgccatcccgtgggtgctcgcctgg
tcccagtcgcgtgtgctgctgccgggctggttcggcgtcggcacggccctggccgagtgg
atcggggagggggaggacagggacgagcgcatcgccgagctgcgggagctctacgagtcc
tggcccttcttcacctcgatcatgtccaacatggcgcaggtcatgtcgaaggcgggcatg
gatctcgcggagctctacgcccggctcatcgacgaccgggaggtcgccgagcgcgtccac
ggtgtcatcacggaggagttcgagctcacccgcgagatgttcagcaccgtcaccggcagc
gccgagctgctcgccgacaacccggcgctggcccgttcggtgcgcaggcgcttcccgtac
ctgctgccgctcaacatcatccagctggagctgctgcgccgccaccgtgccggcgactcc
cgacgcgccgtgtcccgcggcatccagctgacgatgaacggactcgccaccgcactgcgc
aactccgggtag

DBGET integrated database retrieval system