KEGG   Chondrocystis sp. NIES-4102: NIES4102_14130Help
Entry
NIES4102_14130    CDS       T05085                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
chon  Chondrocystis sp. NIES-4102
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:chon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES4102_14130
Enzymes [BR:chon01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     NIES4102_14130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1631941..1632849)
Genome map
AA seq 302 aa AA seqDB search
MIDIQQLNADYGITNKVKFTEGQGGLPMIEVQNEYAQATISLYAGQVLSFKPVNQTEDVM
FVSKQAYYQVGKAIKGGTPICWPWFGPDPENQGRSSHGFVRNRLWQMRDVSSTIDGATKV
VLGLEATAETQAIWNYDFDLAIAITVGNTLTIELITRNTGKQAFSITQALHTYFQIADLN
QVEVLGLENKTYIDKVDGGKEKTQSGVITFSGECDRIYLDVPATLIIKDASLNRKIKITA
TNSKTAIVWNPGSIISASMADLDDQDYQHFVCVETANAADEIIEIPAASEYKLTANYAVE
SL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatattcaacagttaaatgcagattacggcattactaataaagtaaaattcact
gagggtcaaggtggtttgccaatgatcgaagttcaaaatgaatacgctcaagccactatc
tctctatatgcaggtcaagtattatcttttaaacctgttaaccaaactgaagatgtgatg
tttgttagtaagcaggcttattatcaagttggtaaagctataaaaggtggtacaccaatc
tgttggccttggtttgggccagatcctgaaaatcaaggacgctccagtcatggttttgtg
cgtaatcgtctttggcaaatgcgagatgttagcagcactattgacggcgcaactaaagtt
gttttgggtttagaagccacagcagaaactcaagcgatctggaattatgattttgatttg
gcgatcgccattacagtcggtaacactctaaccatcgaattaattacgcgcaacacaggg
aaacaagcattctctattacccaagctcttcatacttattttcagatcgcagatctcaat
caagtcgaggtattaggtttggagaataaaacttatatagataaagttgatggaggtaaa
gagaaaacccagtcaggagtaataacattttctggcgaatgcgatcgtatctatcttgat
gtcccagccacattaataattaaagatgcttccttaaatagaaagattaaaattaccgcc
accaacagcaaaaccgcaattgtttggaatcctggctcgataatctccgctagtatggct
gatttagatgaccaagattatcaacactttgtctgtgtggaaactgctaacgcagcagat
gaaattattgagattccagcagcaagcgagtataaacttactgctaactatgcagttgaa
tctttatag

DBGET integrated database retrieval system