KEGG   Chondrocystis sp. NIES-4102: NIES4102_28360Help
Entry
NIES4102_28360    CDS       T05085                                 

Gene name
rbcS
Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
chon  Chondrocystis sp. NIES-4102
Pathway
chon00630  Glyoxylate and dicarboxylate metabolism
chon00710  Carbon fixation in photosynthetic organisms
chon01100  Metabolic pathways
chon01120  Microbial metabolism in diverse environments
chon01200  Carbon metabolism
Module
chon_M00165  Reductive pentose phosphate cycle (Calvin cycle)
chon_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
chon_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:chon00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES4102_28360 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES4102_28360 (rbcS)
Enzymes [BR:chon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NIES4102_28360 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAZ45810
UniProt: A0A1Z4RTL6
LinkDB All DBs
Position
3227259..3227594
Genome map
AA seq 111 aa AA seqDB search
MKTLSKERRYETLSYLPPLTDQQIAKQIDYMIAQGYIPGVEFEKDPTPDLHHWTLWKLPL
FSARSSQEVLNEVRECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKPNQNRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattatcaaaagaacgtcgttacgaaactctttcatatttaccccctttaaca
gatcagcaaatcgctaaacagatcgattatatgatcgctcaaggttatattcctggtgta
gaatttgaaaaagatcctactccagatctacaccactggactttatggaaattacctcta
ttctctgctcgtagttctcaagaggtattaaatgaagtgcgtgagtgtcgttctgaatat
tctgattgctatattcgtgtagttggatttgacaacattaaacaatgtcaaactgttagt
tttattgtttataaaccaaatcaaaaccgctactaa

DBGET integrated database retrieval system