KEGG   Chondrocystis sp. NIES-4102: NIES4102_28360Help
Entry
NIES4102_28360    CDS       T05085                                 

Gene name
rbcS
Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
chon  Chondrocystis sp. NIES-4102
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:chon00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES4102_28360 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES4102_28360 (rbcS)
Enzymes [BR:chon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NIES4102_28360 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3227259..3227594
Genome map
AA seq 111 aa AA seqDB search
MKTLSKERRYETLSYLPPLTDQQIAKQIDYMIAQGYIPGVEFEKDPTPDLHHWTLWKLPL
FSARSSQEVLNEVRECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKPNQNRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattatcaaaagaacgtcgttacgaaactctttcatatttaccccctttaaca
gatcagcaaatcgctaaacagatcgattatatgatcgctcaaggttatattcctggtgta
gaatttgaaaaagatcctactccagatctacaccactggactttatggaaattacctcta
ttctctgctcgtagttctcaagaggtattaaatgaagtgcgtgagtgtcgttctgaatat
tctgattgctatattcgtgtagttggatttgacaacattaaacaatgtcaaactgttagt
tttattgtttataaaccaaatcaaaaccgctactaa

DBGET integrated database retrieval system