KEGG   Chryseobacterium sp. T16E-39: CEY12_14605Help
Entry
CEY12_14605       CDS       T04952                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
chry  Chryseobacterium sp. T16E-39
Brite
Enzymes [BR:chry01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CEY12_14605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ASK31258
UniProt: A0A220SDA5
LinkDB All DBs
Position
complement(3239350..3239853)
Genome map
AA seq 167 aa AA seqDB search
MKVQKFALLTGLALFAVSCGTTNTYMVNAKSGTNTGGTAKFTQKGDEVIMKLDVTNLTPG
IHAVHIHEKGDCSAADGTSTGGHWNPAKDDHGKWGAEHFHMGDIGNLVADQSGTATLTFK
TNKWCVGCADESKNIIGKGLIVHAAADDFHTQPTGNAGGRVGCVEIK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacaaaaatttgcattattaacgggattggccttatttgctgtttcttgtgga
acaacaaacacatacatggtcaatgctaaaagcggaacgaatactggtggaactgctaag
ttcacccagaaaggagatgaagttatcatgaagcttgatgtaactaatttaactccggga
atccatgccgtacacattcacgaaaaaggagattgctcggctgctgatggaacttctaca
ggaggacactggaatcctgcaaaagatgatcacggaaaatggggagcggaacatttccat
atgggagacatcggtaaccttgtcgctgatcagagtggaacagcaactttaacattcaaa
accaataaatggtgtgtaggatgtgccgatgagtctaagaatattattggaaaaggtctt
attgtacatgcagcagcagatgactttcacacacagccaacaggaaatgccggaggccgt
gtaggatgtgtagagatcaaataa

DBGET integrated database retrieval system