KEGG   Capra hircus (goat): 100860905Help
Entry
100860905         CDS       T02910                                 

Gene name
PTGS2, COX-2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
chx  Capra hircus (goat)
Pathway
chx00590  Arachidonic acid metabolism
chx01100  Metabolic pathways
chx04064  NF-kappa B signaling pathway
chx04370  VEGF signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04668  TNF signaling pathway
chx04723  Retrograde endocannabinoid signaling
chx04726  Serotonergic synapse
chx04913  Ovarian steroidogenesis
chx04921  Oxytocin signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx05140  Leishmaniasis
chx05165  Human papillomavirus infection
chx05167  Kaposi's sarcoma-associated herpesvirus infection
chx05200  Pathways in cancer
chx05204  Chemical carcinogenesis
chx05206  MicroRNAs in cancer
chx05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100860905 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100860905 (PTGS2)
   04064 NF-kappa B signaling pathway
    100860905 (PTGS2)
   04668 TNF signaling pathway
    100860905 (PTGS2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100860905 (PTGS2)
   04657 IL-17 signaling pathway
    100860905 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100860905 (PTGS2)
   04913 Ovarian Steroidogenesis
    100860905 (PTGS2)
   04921 Oxytocin signaling pathway
    100860905 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    100860905 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100860905 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100860905 (PTGS2)
   05206 MicroRNAs in cancer
    100860905 (PTGS2)
   05204 Chemical carcinogenesis
    100860905 (PTGS2)
   05222 Small cell lung cancer
    100860905 (PTGS2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100860905 (PTGS2)
   05165 Human papillomavirus infection
    100860905 (PTGS2)
   05140 Leishmaniasis
    100860905 (PTGS2)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100860905 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 100860905
NCBI-ProteinID: XP_017916220
LinkDB All DBs
Position
16
AA seq 604 aa AA seqDB search
MLARALLICAAVALCGAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPDTVHYILTHFKGVWNIVNKISFLRNMIMRYVLTSRSHLIESPPTYNVHY
SYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEVVKKVLLRRKFIPDPQGT
NLMFAFFAQHFTHQFFKTDIERGPAFTKGKNHGVDLSHVYGESLERQHKLRLFKDGKMKY
QMINGEMYPPTVKDTQVEMIYPPHIPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLEHGVTQFVESFTRQIAGRV
AGGRNLPAAVEKVSKASLDQSREMKYQSFNEYRKRFLLKPYESFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIQSLICSNVKGCPFTSFSVQDAHLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgggccctgctgatctgcgccgccgtggcgctctgcggtgcagcaaatccc
tgctgttcccatccatgccagaatcgaggtgtatgtatgagtgtaggattcgaccagtat
aaatgtgactgtacccgaacaggattctatggtgaaaactgtaccacacctgaatttctg
acaagaataaaattactcctgaaacctactcccgacacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataagatctccttcctgcgaaatatgattatgaga
tatgtgttgacgtcaagatcacatttgattgagagtccgccaacttataatgtgcactac
agctataaaagctgggaagccttttctaacctgtcctattataccagagctcttcctcct
gtgcctgatgactgcccaacacccatgggtgtgaaagggaggaaagagcttcctgattcg
aaagaagttgtgaaaaaagtacttctaagaagaaagttcattcctgatccccagggcaca
aatctgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatatt
gaacgaggaccagctttcactaagggaaagaaccatggggtggacttaagtcatgtttat
ggtgaatctttagagagacagcataagctgcgccttttcaaggatggaaaaatgaaatat
cagatgattaatggagagatgtatcctcccactgtcaaagatactcaggttgaaatgatc
tacccacctcatattcctgaacacttgaagtttgctgtaggccaggaggtctttggtctg
gtgcctggtctgatgatgtatgccaccatttggctgcgggaacacaacagagtgtgtgat
gtgcttaaacaagagcatccagaatggggcgatgagcagttgttccagacaagcaggcta
atcctgataggagaaactattaagattgtgattgaagactacgtacagcacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacagttccagtaccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctgcctgacgtc
tttcagattgatggccaggagtacaactatcagcagtttatctataacaactctgtctta
ctggaacatggtgtcactcagtttgttgaatcatttaccaggcaaattgctggcagggtc
gctggcggtaggaatcttccagccgcagtagagaaagtatcaaaggcttcacttgaccag
agcagagagatgaaataccagtcttttaatgagtatcgcaaacgttttctgctgaagccc
tatgaatcttttgaggaacttacaggagagaaggaaatggctgcagagttagaagcgctc
tacggagacatagatgccatggagctgtatcccgcccttctggtagagaagccccgtccc
gacgccatctttggggagaccatggtagaagccggagcaccattctccctgaaaggactt
atgggtaatcctatatgttctcctgagtactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcaattcagtctctcatctgcagtaacgtgaaaggc
tgtccctttacctcattcagtgttcaagatgcacacctcaccaaaacagtcaccattaac
gcaagctcttcccactcgggactagacgatatcaaccccacagtcctactaaaggaacgt
tcaactgaactgtag

DBGET integrated database retrieval system