KEGG   Capra hircus (goat): 102171327Help
Entry
102171327         CDS       T02910                                 

Gene name
POLRMT
Definition
(RefSeq) RNA polymerase mitochondrial
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     102171327 (POLRMT)
Mitochondrial biogenesis [BR:chx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    102171327 (POLRMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N PPR_3 PPR_2
Motif
Other DBs
NCBI-GeneID: 102171327
NCBI-ProteinID: XP_017905996
LinkDB All DBs
Position
7
AA seq 1221 aa AA seqDB search
MSALRCGRGAAGLRRALWPKGYPCLLAEEGTLGGVWGRKRSLSASACEQDRRKGCGHAEL
LEVLEARVRQLQAEGTAEEVTVKRVAVAQAPEAGGIWPPRQAPLGAEGAVPMLSSRWAQK
LDKDQHLIEKRWQQLDGKLPKMVEKPTWEKHLRTEPRLLSRKLAGQLQQWERKRPQSPWE
EQLARLLQEAPQRLSREADEGSESRLEGQRQKLLAFLECCLLTGHLPLAHHVLVAQHSRA
PQQQLLTLPMYNTVMLGWARQGSFKELMYVFFMLKDAGLAPDLLSYAAALQCMGRLDQDA
GTIQRCLKQMEQDRLSLQGLFSAVPLSAEEREELLRAVRKARPAFSPQPPPPPPPQVNTS
PLLQEIYAKDPSVSYPKLHLSLKELQGLFRQQLGVEMATTVTVESVEKAPLLTEEVLQAR
KTLAALRAEWESVLSLELQEIKESEARAAAEGRPSLFPYLCLLSEKELVGLLLQTLQALP
PHGESLLFLAHELGVRVLKRKRLRNQVEELEQRYSEYLHLLASDTQVAEPCLPRQHWEAL
GMPEAPPEQPWPMSVLVQLGKQLAEVLVRAVQMPSSLAAPRGPSTLIPVLYHVYSFRSFR
QIGILKPHPAFTQLQETAAERTLIFESTEVPMLCPPLPWTSPHSGAFLLSPTKMMRSLEG
TQQHQLLLERCPPAELHGALDALTQLGNCAWRVNGRVLDLVLDLFRDKGCPRLGVPSPPT
EAPRPPEGRQAPKGCLLPEASPADKAEMRRELARRLKVAREMQSLRADALYRLSLAQHLR
NHVFWLPHNMDFRGRTYPCSPHFNHLGSDLARALLEFAQGRPLGPHGLDWLKIHLVNLTG
LKKRESLQTRRDYADAVMEDILDSAERPMTGRKWWMEADEPWQTLACCMEIAQVVHSPDP
TTYISHFPVHQDGSCNGLQHYAALGRDSTGATSVNLSPSDLPQDVYSEVAAQVEVFRKQD
AKQGVRVAQVLEGFISRKVVKQTVMTVVYGVTRYGGRLQIERRLRELEDFPQEFVWEASH
YLVRQVFNSLQEMFSGTRSIQRWLTESARLISLTGSAVEWITPLGVPIIQPYHRDSKVMI
KGGLQSLTFSSSVDTNQKPNTLKQKNGFPPNFIHSLDSTHMMLTALHCYRKGLTFVSVHD
CFWTHAADVGVMNQVCREQFVRLHSQPILHDLSRFLLKRFCPDSRTSKSMWVSRLKDTLL
SVPPTGTFDLEQVKHSTFFFS
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgctgcgctgtggccgcggggcggcggggcttcggagggccctgtggccgaag
ggctacccctgcctcctggccgaagaagggacccttggtggcgtctggggccggaagagg
agcttgtctgccagcgcttgtgagcaggaccgccggaagggctgcggtcacgcagaactg
ctggaggtgcttgaggcacgggtgcggcaactgcaggcggagggcacagcagaggaggtg
acggtgaagagggtggccgtggctcaggcgccggaggctggtggcatctggccccccagg
caggccccacttggggctgaaggggctgtccccatgctcagcagccgctgggcacagaag
ctggacaaggatcagcacctgatagagaagcgctggcagcagctggatgggaagctgccg
aagatggtggagaagccgacctgggagaagcatctgcgcacggagccgcggctgctgagc
aggaagctggcgggccagctgcagcagtgggagcgcaagaggccgcagagcccctgggag
gagcagctggcccggctgctgcaggaggccccgcagagactgagccgggaggcagatgag
ggctctgaatcccggctggagggccagcgccagaagctcctggccttcctggaatgctgc
ctgctcacgggccacctgcccctggcccaccacgtgctggttgcacagcacagccgggcc
ccacagcagcagctgctcacactccccatgtacaacaccgtcatgcttggctgggctcgc
cagggctccttcaaagagctgatgtacgtgttcttcatgctgaaagatgccggcctggcc
ccggacctgctgtcctatgcagccgccctgcagtgcatggggcgcctggaccaggatgcc
ggcaccatccaaaggtgcctgaagcagatggagcaggacaggctgtcgctgcaggggctc
ttctcagctgtgcccctgagcgctgaggagcgggaggagctcctgcgtgctgtgcgcaag
gccagaccagcgttcagcccccagccgccacccccgcccccaccccaggtcaacacctcg
ccactgctccaggagatctacgccaaggacccctctgtgtcctacccgaagctgcacttg
tccctgaaggagctgcagggcctcttccgacagcagctgggcgtggagatggccaccact
gtcaccgtggagtccgtggagaaggccccgctcctgaccgaggaggtcctacaggcgcgg
aagaccctggcggccttgcgcgcagaatgggagtcggtgctgtccctggagctgcaggag
atcaaggagagtgaggcccgcgctgccgcagaaggccgcccatccctcttcccctacctg
tgcctgctcagtgagaaggaattagtggggctgctgctgcagaccctgcaggcgctgccc
ccgcatggagagtcactcctcttcctggcgcacgagctgggcgtgcgtgtgttgaagagg
aagcggctcaggaaccaggtggaagagctggagcagcgctactctgagtacctgcacctg
ctggcctcggacacccaggtagcagagccctgtctgcctcgccagcactgggaagcgctg
ggcatgcctgaggcccccccggagcagccctggcccatgtctgtgctggtgcagctgggc
aagcagctggcagaggtgctggtacgagccgtgcagatgcccagcagcctggcagcgccc
cggggccccagcacactcattcctgtgctctaccacgtgtattccttccgcagcttccgc
cagatcgggatcctgaagccacatccagccttcactcagctgcaggagacggcggcggag
cgcacactgatctttgagtccacggaggtgcccatgctgtgcccacccctgccctggacg
tcaccacactcgggcgccttcctgctgagccccaccaagatgatgcggtccctggagggc
acccagcagcaccagctcctgctggagcgctgcccgcccgccgagctgcatggcgctctg
gatgccctcactcagctgggcaattgcgcttggcgcgtcaatgggcgtgtgctcgacctg
gtgcttgacctcttcagggacaagggctgccctcgcctgggcgtgccctccccgcccacc
gaggccccccggccccccgagggccgccaggcccccaagggctgcctgctgcccgaggcc
tcacctgctgacaaggcagagatgcggcgggagctggcacggcggctgaaggtggcacgg
gagatgcagagcctgcgcgcagacgcactctaccgcctgtcgctggcccagcatctgcgg
aaccacgtcttctggctgccgcacaacatggacttccgaggccgtacctacccctgttca
ccacacttcaaccaccttggcagtgacctggcccgcgcgctgctggaatttgcccagggc
cgcccacttggcccccatggcctcgactggctcaagatccacctggtcaacctcacaggg
ctcaagaagcgcgagtcactacagacgcgccgggactacgcagacgcagtgatggaggac
atcctggactcagctgaacgacccatgacgggccggaagtggtggatggaggcggatgag
ccgtggcaaaccctggcctgctgcatggagattgcccaggtggtgcactcccccgaccct
accacctacatctcccactttccggttcaccaggacggctcctgtaatggtctccagcac
tatgccgccctgggccgggacagcacgggggccacctccgtcaacctgtcaccctctgac
ctgccacaggacgtgtacagtgaggtggctgcacaggtggaggtattccgcaagcaggat
gccaagcagggcgtgcgggtggcccaggtgctggagggcttcattagccgcaaggtggtc
aagcagacagtgatgaccgtggtgtatggtgtcacccgctatggcggccgcctgcagatc
gagaggcgcctccgggagctcgaggacttcccccaggagttcgtatgggaggcatctcac
tacctcgtgcgccaggtgttcaacagcctccaggagatgttctctggcacccggtccatc
cagcgctggctgactgagagtgcccggctcatctcactcacgggctcggctgtggagtgg
atcacgcccctgggcgtccccatcatccagccctaccaccgagactccaaggtcatgata
aaaggcgggctccagagcctcactttcagcagcagtgtggacaccaaccagaagcccaac
acgttgaagcagaagaacggcttcccacccaacttcatccactcactggactccacgcac
atgatgctcacggccctgcactgttacaggaagggcctgaccttcgtctcggtgcacgac
tgcttctggacgcatgcggctgacgtcggggtcatgaaccaggtctgccgggagcagttt
gtccgactgcacagccagcccatcctccatgacctgtccaggttcctcctcaagcggttc
tgccccgattctagaacctccaagagcatgtgggtctccaggctaaaggacacgctgctg
tctgtgcctccgacagggacctttgacctggagcaggtgaagcattccacgttcttcttc
agctga

DBGET integrated database retrieval system