KEGG   Capra hircus (goat): 102177869Help
Entry
102177869         CDS       T02910                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
chx  Capra hircus (goat)
Pathway
Alcoholism
Human papillomavirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:chx00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102177869 (HDAC7)
  Substance dependence
   05034 Alcoholism
    102177869 (HDAC7)
  Infectious diseases
   05165 Human papillomavirus infection
    102177869 (HDAC7)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102177869 (HDAC7)
Chromosome [BR:chx03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102177869 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
5
AA seq 995 aa AA seqDB search
MCARGPGRPRGCVRSDGTQVSPAAPCSSPPIIGWPRPRADTPGPQPQPMDLRVGQRPAVD
APPEPTLLALQHPQRLHHHLFLAGLQPQRSAEPMRLSMDTPMPELQMGQQEQELRQLLNK
DKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPSVPYRTLEPLETEGAARSMLGS
FLPPVPSLPCDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAE
TLGDSSPSSSSTPASGCSSPNDSEHGPNPVLGSEAHLGQRLRLQETSLAPLALLPTITLG
LPAPARADGDRRTHATLGPRGPVLGNPHAHLFLPHGLEPEAGGPLPSRLQPILLLDPSVS
HTPLLTVPGIGPLPFHFAQSLLTTERPSGSGLHRPLSRTRSEPLPPSATAPSLLGPLQPR
LERLKPHVQLIKRSAKPSEKPRLRQIPSAEDLETDSGSVGPLQDDGLEHRESSHGQQEAR
GPVPLQQHQQVFLWEQQRLAGRLPRGATGDSMLLPLAPGSHRPLSRAQSSPAAPASLPTP
EPASQARILPSSETPARTLPFTTGLVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLLE
RGLRSQCESLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLP
CGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAM
GFCFFNSVAIACRQLQQQGKASKILIVDWDVHHGNGTQQTFYQDPNVLYISLHRHDDGNF
FPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVS
AGFDAAEGHPPPLGGYHVSAKCFGYMTQQLMSLAGGAVVLALEGGHDLTAICDASEACVA
ALLGNKVDPLSEEGWKQKPNLNAIRSLEAVIRVHSEYWGCMQRLASRPDSWVHRVPGADA
EEVEAVTALASLSVGILAEERTSGQLVEEEEPMNL
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctcgcggccccggtcgcccgcgagggtgcgtgcgctcagatgggacccaggtg
agcccggctgccccctgctccagcccgcccatcataggctggcccaggccccgcgcagac
acgccaggccctcagccccagcccatggacctgcgggtgggccagcggcccgcggtggat
gccccgccggagcccacactgctggccctgcagcacccccagcgcctccaccaccacctc
ttcttggcgggcctgcagccccagcgctcggcagagcccatgcggctctcaatggacacg
ccgatgcccgagttgcagatggggcagcaggaacaagagctgcggcagcttctcaacaag
gacaagagcaagcgaagtgccgtagccagcagtgtggtcaagcagaagctggcagaggtg
attctgaagaaacaacaggcggccctagagagaacggttcatcctaatagccccagcgtt
ccctacagaactctcgagcccttggagacggagggagctgcccgttccatgctcggcagc
ttcctgcctcctgttcccagcctgccttgcgaccccccagaacacttccctctgcgcaag
acagtctccgagcccaacctgaagctgcgctacaagcccaagaagtccctggagcggagg
aagaacccgctactgcggaaggagagcgcccctcccagcctccgtcggcggccggcagag
acccttggcgactcctccccgagtagtagcagcacgccggcatcagggtgcagctccccc
aacgacagcgagcatggccccaaccccgtcctgggctccgaggcgcacttgggccagcgg
ctgcggctgcaggagacctctctggccccgctcgccttgctgcccacaatcacactgggg
ctgcccgcccctgccagggctgatggtgaccgcaggacccatgcgactctgggccctcgg
ggcccagtcctggggaacccccatgctcacctcttcctgccccatggcctggagcccgag
gctgggggccccctgccctctcgcctgcagcccattctcctcctggatccctcagtgtct
cacacccctctgctgactgtgcccgggattgggccactgcccttccactttgcccagtcc
ttactgaccaccgagcggccctctggatcaggcctccaccggccactgagccggacccgc
tcagagcccctgcccccaagcgccactgccccctcactgctgggccccctgcagccccgc
ctggagcggctcaaacctcacgtccagctgatcaagaggtcagccaagccgagtgagaag
ccccgactgcggcagataccctcagctgaggacctcgagacggacagtgggagtgtgggg
ccgctgcaggatgatggcctggaacatagggagtccagtcatgggcagcaggaggccaga
ggccctgttcctctccagcagcaccagcaggtgttcctctgggagcagcagcggctggct
gggcggctcccccgaggagccactggagactccatgctgcttcccctggccccgggcagt
caccggcccctgtccagggctcagtcgtccccggccgcacctgcctcgctgccgacccca
gagcccgccagccaggcccgtatcctgcccagctcagagacccctgcccggaccctgccc
ttcaccacggggctggtctatgactcggtgatgctgaagcaccagtgctcctgtggggac
aacagcaggcacccggagcacgcgggccgtatccagagcatctggtcccggctgctggaa
cgggggctccggagccagtgtgagtctctccggggccggaaggcctccctggaggagctg
cagtcggtgcactctgagcggcacgtactcctctacggcaccaacccgctcagccgcctc
aaactggacaatgggaagctggcaggcctcctggcacagcggatgttcgtgatgctgcct
tgtggcggcgttggggtggacaccgacaccatctggaatgagctgcactcctccaatgcg
gcccgctgggctgctggcagtgtcaccgacctcgccttcaaagtggcctcccgtgagcta
aagaatggttttgctgtggttcggcccccaggacaccatgcagaccattccacagccatg
ggcttctgcttcttcaactcagtggccatcgcctgccggcagctacaacagcaaggcaag
gccagcaagatcctcattgtggactgggacgttcaccatggcaacggcacccagcagacc
ttctaccaggaccccaatgtgctgtacatctcccttcatcgccatgatgatggcaacttc
ttccctggcagtggggctgtggatgaggtgggagctggcagcggtgagggcttcaatgtc
aacgtggcctgggctggaggtcttgaccctcccatgggggatcctgagtacctggctgcc
ttcaggatagttgtgatgcccatcgcccgggagttctctccggacctggttctggtgtcg
gctgggtttgatgctgccgagggtcacccgcccccactgggtggctaccatgtttctgcc
aagtgctttgggtacatgacacagcagctcatgagcttggctggaggtgcggtggtgctg
gccctggaggggggccatgacctcacagccatctgtgatgcctccgaggcctgcgtggct
gctcttctgggcaacaaggtggatcccctctcagaagaaggctggaagcagaaacccaac
ctcaatgccatccgctccctggaagctgtgatccgagtgcacagtgaatactggggctgc
atgcagcgcctggcctcccgtccagactcctgggtgcacagggtgccaggggccgatgca
gaagaagtggaggcagtgacggcgttggcatccctctccgtgggcatcctggctgaagag
cggacctcagggcagctggtggaggaggaggaacccatgaatctctga

DBGET integrated database retrieval system