KEGG   Capra hircus (goat): 102178638Help
Entry
102178638         CDS       T02910                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
chx  Capra hircus (goat)
Pathway
chx00250  Alanine, aspartate and glutamate metabolism
chx00410  beta-Alanine metabolism
chx00430  Taurine and hypotaurine metabolism
chx00650  Butanoate metabolism
chx01100  Metabolic pathways
chx04727  GABAergic synapse
chx04940  Type I diabetes mellitus
Module
chx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102178638 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102178638 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102178638 (GAD2)
   00430 Taurine and hypotaurine metabolism
    102178638 (GAD2)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    102178638 (GAD2)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    102178638 (GAD2)
Enzymes [BR:chx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102178638 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 102178638
NCBI-ProteinID: XP_017912601
LinkDB All DBs
Position
13
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDPENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SQPQRATSRKAACACNQKPCSCPKAEVNYAFLHATDLLPACDGERPTLAFLQEVMDILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYVPPSLRVLDNDEERLSRLSKVAPVIKARMMEH
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccgggctccggcttttggtccttcggatctgaagatggctcgggggatccc
gagaaccccggcacagccagggcctggtgtcaggtggcccagaagttcacgggcggcatc
ggaaacaaactgtgcgccctgctctatggagacgccgagaagccggcggagagcggcggg
agccagccccagcgggccacctcccgcaaggccgcctgcgcctgcaaccagaagccctgc
agctgccccaaagcggaggtcaactatgcatttctacacgcaacagatctgctgccagcg
tgtgatggggaaaggcccactttggcgtttctgcaagaggttatggacattttgcttcag
tatgtggtgaagagttttgatagatcaaccaaagtgattgattttcattaccctaatgag
cttcttcaagaatataattgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacagggcatccaaggtatttcaat
caactttctaccggactggatatggttggattagcagcagactggctgacatcaacagca
aacactaacatgttcacctatgaaattgctccagtatttgtgcttttggaatatgtcacg
ctaaagaaaatgagagaaatcattggctggcctgggggctctggtgatgggatattttct
cctggtggcgctatatccaacatgtacgccatgctgattgcgcgctttaagatgttcccg
gaagtcaaggagaaagggatggctgccgtccccaggctcattgccttcacgtctgagcat
agccatttttctctcaagaagggagctgcagccttgggcattggaacagacagtgtgatt
ctgattaaatgtgatgaaagggggaaaatgatcccatctgaccttgaaagaaggatcctt
gaagccaaacaaaaagggtttgtccctttccttgtgagcgccacggctgggaccactgtg
tatggagcctttgaccctctgttagcggttgctgacatttgcaaaaagtataagatctgg
atgcacgtagatgcagcttggggtgggggattactgatgtctcggaaacacaagtggaaa
ctaagcggcgtggagagggccaactctgtgacctggaatccgcataagatgatgggtgtt
cctttgcagtgctctgctctcctggttagagaagagggattgatgcagagttgcaaccag
atgcatgcctcctacctcttccaacaagataaacactatgacctgtcctatgacactgga
gacaaggccttgcagtgcggacgccatgttgatgtttttaaactctggctaatgtggagg
gcaaaggggaccacaggatttgaagcacatattgataagtgtttggagctggcggagtat
ttatacaatatcatcaaaaaccgagaaggttatgaaatggtgtttgatggaaagcctcag
cacaccaacgtctgcttctggtacgtacctccaagcctgcgtgtcctggacaacgatgaa
gagagactgagccgcctctccaaggtggctcccgtgattaaagccaggatgatggagcat
gggaccacaatggtgagctaccagcccttgggcgacaaggtcaacttcttccgcatggtc
atctcaaaccccgcagcaactcaccaagacattgacttcctgattgaagaaatagaacgc
cttggacaagatttataa

DBGET integrated database retrieval system