KEGG   Capra hircus (goat): 102183107Help
Entry
102183107         CDS       T02910                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  
succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
chx  Capra hircus (goat)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102183107 (SDHA)
  Energy metabolism
   00190 Oxidative phosphorylation
    102183107 (SDHA)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    102183107 (SDHA)
   05012 Parkinson's disease
    102183107 (SDHA)
   05016 Huntington's disease
    102183107 (SDHA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102183107 (SDHA)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102183107 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
20
AA seq 665 aa AA seqDB search
MSGVAAVSRLLRARRLALNCTKRPAAWQTGARDFHFTVDGNKRSSAKVSDAISAQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMESGECRGVIALCI
EDGSIHRIRARNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLKHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
KVPSIKPNAGEESVMNLDKLRFANGSIRTSELRLNMQKSMQSHAAVFRVGSVLQEGCEKI
SSLYGDLRHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKE
RVDEYDYSKPVQGQQKKPFEQHWRKHTLSYVDVKTGEVTLEYRPVIDRTLNETDCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggttgccgctgtgtcgcgcttgctgcgcgcccggcgcctggcgctgaactgc
acgaagcggccggcagcatggcagacaggagcccgcgactttcacttcaccgttgacggc
aataagaggtcgtccgctaaagtttcagatgcgatttctgcacagtacccagtcgtggac
catgagtttgatgccgtggtggtcggtgcagggggggcaggcctgcgggccgcgttcggc
ctctccgaagcaggtttcaacacggcctgcgtcacgaagctcttccccaccaggtcccat
actgtcgcggcccagggagggatcaatgccgccttggggaacatggaggaggacaactgg
cggtggcacttctacgacaccgtgaagggctccgactggctgggggaccaggacgccatc
cactacatgacggagcaggcccccgcctctgtggtggagctggagaattacggcatgccc
tttagcagaactgaagatgggaagatctaccagcgtgcctttggtggacagagcctcaag
ttcgggaagggcgggcaggcccaccgctgctgctgcgtggctgaccgcacgggccactcg
ctgctgcacacgctgtatggaaggtccctgcgctacgacaccagctactttgtggagtac
ttcgccctggacctcctgatggagagcggggagtgccgcggcgtgatcgctctgtgcata
gaagacgggtccatccaccgcatcagggccaggaacaccgtcatcgccaccggaggctac
gggcgcacctacttcagctgcacgtcggcgcacaccagcaccggggacggcaccgccatg
gtgaccagggctggcctgccctgccaggacctggagttcgtgcagttccaccccacaggc
atatatggcgctggctgtctcatcacggagggctgtcgtggagaggggggcatcctcatc
aacagccagggtgagaggttcatggagcgctatgcccccgtcgctaaggacctggcatct
agggacgtcgtgtcccggtccatgaccctggaaatccgcgagggaagaggctgtgggccc
gagaaggaccacgtgtacctgcagctgcaccacctgccgccagagcagctggccatgcgc
ctgcccggcatctcagagacggccatgatctttgcgggcgtggacgtcaccaaggagccc
atccccgtgcttcccaccgtgcactacaacatgggtggcatccccaccaactacaagggg
caggttctgaagcacgtgaatggccaggaccaggttgtgcccggcctgtatgcatgcggg
gaggctgcctgcgcctcggtgcatggcgccaaccgtctgggtgcaaactcgctcctggac
ctggtggtcttcggccgggcgtgcgccctgagcatcgcagagtcctgcagacctggagat
aaagttccctcaattaaaccaaatgctggggaagaatctgtcatgaatcttgacaaattg
agatttgccaatggaagcataagaacatcggaattgagactcaacatgcagaagtcgatg
cagagccatgccgcagtgttccgtgtgggcagtgtgctgcaggaaggctgtgagaagatc
agcagcctctacggagacctgcggcatctgaagacgttcgacaggggaatggtctggaac
actgacctggtggagaccctggagctgcagaacctgatgctttgtgctctgcagaccatc
tacggagcggaggcccggaaggagtcgcgtggcgcccacgccagggaggacttcaaggag
agggttgacgagtacgattactccaagcccgtccaggggcagcagaagaagccgtttgag
cagcactggaggaagcacacgctctcctacgtcgacgtcaagactggggaggtcaccctg
gaatacagacctgtaatcgacaggactttgaacgagaccgactgtgccactgtcccccca
gccatccgctcctactga

DBGET integrated database retrieval system