KEGG   Capra hircus (goat): 102188149Help
Entry
102188149         CDS       T02910                                 

Gene name
TGM3
Definition
(RefSeq) transglutaminase 3
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102188149 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 102188149
NCBI-ProteinID: XP_005688282
LinkDB All DBs
Position
13
AA seq 691 aa AA seqDB search
MSGLQGVNWQTASNRQAHHTDRFYGQDLIVRRGQPFHMSVTLSRGLSSGGSVTFTVSTGP
YPSESAKTKAVFPLSNGTSSSGWGAQLVSNRNNVLNISILSPANAPIGRYTLNMQISSQG
SDSMLKLGTFILLFNPWLQADGVFMSNHAEREEYVQEDAGIIFVGSTNRIGMIGWNYGQF
EEGILNICLSVLDNSLNFRRDPATDVAHRNDPKYIGRVLSAMINANDDNGVISGNWSGSY
TGGRDPRNWNGSVEILKEWQRSGFRPVRYGQCWVFAGTLNTVLRCLGIPSRVITNFNSAH
DTDRNLSVDVYYDPLGRPVEKGSDSVWNFHVWNEAWFVRPDLGPSYNGWQVLDATPQERS
QGVFQCGPASVIAIREGNVDWDFDMPFIFAEVNADRITWIYESNGALKKNSSDTHSVGKY
ISTKAVGSNSRVDVTEKYKYPEGSSQERQVFEKALRKLKPRASFSATSASSLARDEPEPS
ISGRFKVAGVLAVGKEVNLILILKNLTSDAKTVTVNMTAWTIVYNGTLVHEVWKDSVTKS
LNPEEEIEHPVKITYAQYEKYLKADNMIRATAVCQVTDEPEVVVERDVILDNPTLTLEVL
DEARVQKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGSLKIDVPALRPKERSRVRFEIL
PTRSGTKQLLANFSCNKFPAIKAMLSVDVAE
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtctggactccagggtgtcaactggcagacagcctccaaccggcaggcacatcacaca
gacaggttctacggccaggatctcatcgtacggagaggccagcccttccatatgtcagtg
accttatcccgaggtctcagctctggaggaagtgtgacattcacagtttccacagggcct
tacccctcagagtcggccaagacaaaggctgtgtttccactctccaatgggacaagtagc
agcggctggggtgcacaacttgtgtccaacaggaacaatgttctgaacatctccatcctt
agccctgcaaacgcacccattgggaggtacacgctaaacatgcagatctcctcccagggc
agtgactccatgctgaaacttgggacattcatactgctctttaatccctggctgcaagct
gatggtgtctttatgagtaaccatgctgagagagaggaatatgttcaggaagatgctggc
atcatctttgtgggaagcacaaatcgaattggcatgattggctggaactacggacagttt
gaagaaggcattctgaacatttgcctctcagtcctggataacagtctaaattttcgccgt
gaccctgctacggatgtggcccacagaaacgaccccaaatatattggccgggttctgagt
gcaatgatcaatgccaatgatgacaatggcgtgatttctgggaactggagcggtagctac
actggtggccgggatcctaggaactggaatggcagcgtggagatcctcaaggagtggcaa
agatctggcttcaggcccgtccggtacggccagtgctgggtctttgctggaaccctcaac
acagtgttgcgatgtttggggattccctcccgagtgatcaccaacttcaactcagctcat
gacacagacagaaacctcagcgtggatgtctactacgaccccttgggacggcccgtggaa
aaaggcagtgatagcgtgtggaatttccacgtctggaatgaagcctggtttgtgcggcct
gacctgggcccttcgtacaacggatggcaggttctggacgccacccctcaggagagaagc
caaggggtgttccagtgcggccctgcttcggtgatcgctatccgagagggtaatgtggac
tgggacttcgacatgcccttcatctttgcggaggtcaatgccgaccgcatcacgtggatc
tacgagtcgaatggtgccttgaagaagaactcctcagacactcacagcgtcggcaagtac
atcagtaccaaggcggtgggcagcaactctcgcgtggatgtcaccgaaaagtacaagtat
ccagaaggttccagccaggaaagacaagtatttgaaaaggctttgaggaaacttaaaccc
agagcatcctttagcgcaacatctgcaagcagcctggcaagagacgaaccggagcctagc
atctctgggaggttcaaggtcgctggtgtactggccgtgggcaaagaagtcaacctgatc
ctaatactcaaaaacctaacaagcgatgcaaagacagtgacagtgaatatgacagcctgg
accatcgtctataacggcactctcgtacacgaggtgtggaaggactctgtcactaaatcc
ctgaatcccgaagaagaaatagagcaccctgtaaagatcacatatgctcagtacgagaag
tacctgaaggcggacaacatgatccgggccacagccgtgtgccaggtcactgacgagcct
gaggtggtggtggagagggacgtcatcctggacaaccccaccctgacccttgaggtgctg
gacgaggcccgggtgcagaagcctgtgaacgtgcagatgctcttttccaacccactggat
gagccggtgaaggactgcgtgctgatggtggagggcagcggcctgctgctgggcagcctc
aagatcgacgtgccagcgctacgccccaaagagcggtcccgcgtgcgttttgagatcctg
cccacccggagtggcaccaagcagctcctcgccaacttctcctgcaacaagtttcccgcg
atcaaggccatgctgtccgttgatgtggctgagtga

DBGET integrated database retrieval system