KEGG   Capra hircus (goat): 106503207Help
Entry
106503207         CDS       T02910                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
chx  Capra hircus (goat)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:chx00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    106503207
   04614 Renin-angiotensin system
    106503207
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    106503207
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    106503207
Enzymes [BR:chx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     106503207
Peptidases [BR:chx01002]
 Metallo Peptidases
  Family M2
   106503207
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106503207
CD molecules [BR:chx04090]
 Proteins
  106503207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
19
AA seq 600 aa AA seqDB search
MPISVSADQLYNETVAKAFLQFYDRTAQVVWNQFMEAAWNYVTNITKKNQEEMLYKDVEK
SQHTLYFGTRARLFKVANFQDSDVKRMLSKLLNVDKAALPKEELREYNEILAYMETTYSM
AQVCLNEGPCLPLEPDLEEVMATSRDQKELLWAWQGWRDAVGRQLRMTFERYVQLSNKAA
KLNGYQDMGALWRSTYESDSLQEDLEQLFQELQPLYLNLHAYVRRALYRFYGPELIDLRG
PIPAHILGNMWAQSWVNILDLALPFPEKPPEDITKIMKGQHWKPEKMFQEAEKFFTSMGL
LSTPPEFWENSMMERPTDGREVECHASAWDFYNGKDFRIKKCTEVTIKDLLSIFHQMGHI
QYFLQYKNLSVIFRAGANPAFEEAVGSVVTLSASSHKHLLNRGLLSQQHQDKEEEVNFLM
SVALEKIAFIPFAYLMDLFRWKVFDGTIEKDVYNQEWWNLRLKYQGLCPPIPRTEEDFDP
GAKFHISASLPYIRYFLSLVLQFQFHEALCKASGHMGPLHRCDIYNSKEAGKLLEDVLKL
GSSKPWPEVLEKMTGETKVSTKALMTYFKPLLNWLVTENVRQGEILGWPDFSCSFEGLMT
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcccatctccgtctctgcagaccagctctacaatgagactgtggcaaaggccttcctg
cagttttacgaccgaacagcccaggttgtgtggaaccagttcatggaggccgcctggaac
tatgtcaccaacatcacaaagaaaaatcaagaggagatgctgtacaaggacgtggagaag
tcccagcacacgctgtactttggcacgcgggcccgcctgtttaaggtcgccaacttccag
gactcggacgtgaagcgcatgctgagtaagctgctgaacgtagacaaggcggccctgccc
aaggaggagctccgggagtacaacgagattctggcctacatggagaccacgtacagcatg
gcccaggtctgcctgaatgaggggccctgcctgcccctggagcctgacctcgaagaagtc
atggccacctcccgagaccagaaggagctgctgtgggcctggcagggctggcgggatgct
gtgggtcgccagctccgcatgacctttgagcgctacgtgcagctcagcaacaaagctgcg
aagctcaatggttaccaagacatgggggccttgtggcggtccacgtacgagtccgactcc
ctgcaggaagacctggagcagctgttccaggagctgcagccgctctacctgaacctgcac
gcctacgtgcggagggccctctaccgcttctatgggcccgagctcatcgacctgaggggg
cccatccccgcccacatcctggggaacatgtgggctcagtcctgggtcaacatcttagac
ctagcgctgcccttcccggagaagccccctgaggacatcacgaagatcatgaaaggccag
cactggaagcccgagaaaatgttccaagaggctgaaaaattcttcacctccatggggctg
ctttccacccctcctgagttctgggaaaactccatgatggaaaggccaactgacgggcgg
gaggtggagtgccatgcgtccgcctgggacttctacaacgggaaggacttcaggataaag
aagtgcaccgaagtgactataaaggacctgctgtccatcttccaccagatgggccacatc
cagtacttcctgcagtacaagaacctctcggtgatcttccgcgcaggcgccaacccagcc
ttcgaggaggccgtggggtcggtggtcaccctctcagcctcctcccacaagcacctgctc
aacagaggcctgctcagccaacagcaccaggacaaagaggaggaggtcaatttcctgatg
agcgttgccctggagaagatcgccttcatccccttcgcctacctgatggacctgtttcgc
tggaaggtctttgatggcaccatcgagaaggacgtgtacaaccaggagtggtggaacctc
aggttgaaataccagggcctgtgccctcccatccctcggacggaggaggactttgatcca
ggcgccaagtttcacatctctgccagcttgccctacatacggtactttctcagcctcgtg
ctccaattccagttccatgaagcactctgcaaggcctcaggccacatggggccgctgcac
cgctgtgacatctataactccaaggaggctgggaagctcctggaggatgtcctgaagctg
ggctcgagcaagccctggccggaggtcctggagaagatgactggggagaccaaggtgtct
acaaaggccctcatgacctacttcaagcccctgctgaactggctggtcactgagaacgtg
cggcagggggagatactgggctggccagacttcagctgttcctttgaaggtttgatgacc
tga

DBGET integrated database retrieval system