KEGG   Citrus clementina (mandarin orange): CICLE_v10022154mgHelp
Entry
CICLE_v10022154mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cic00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CICLE_v10022154mg
Enzymes [BR:cic01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CICLE_v10022154mg
Transporters [BR:cic02000]
 Other Transporters
  Pores ion channels [TC:1]
   CICLE_v10022154mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C GST_N_2 GST_C_3 GST_N_4 GST_C_5 Tom37 GST_C_6
Motif
Other DBs
NCBI-GeneID: 18047134
NCBI-ProteinID: XP_006442222
UniProt: V4TPW1
LinkDB All DBs
Position
Unknown
AA seq 219 aa AA seqDB search
MADEVILLDFWASMFGIRVRIALAEKGVKYEYKEQDLFNKSPLLLRMNPVHKKIPVLIHN
GKSVCESSIIVQYIDEVWKDKAPLLPYDPYQRAQARFWVDFIDKKMYDTSRKTWATKGEE
QEAAKKEFIEVLKTLEGELGDKPFFGGDNFGYVDLCLIPYYCWFYSYETFGKFSVEAECP
KFIAWVKRCLQRETVAKALPDEKKVFEFVSVLREKIRVE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaagtgattctattggatttctgggccagtatgtttgggataagggtcagg
attgctctggcagagaaaggcgtcaagtatgagtacaaagaacaggacttgttcaacaag
agcccgctgcttctgcggatgaatcccgtccacaagaagatcccggttcttatccataat
ggcaaatcggtctgtgagtcatccatcattgttcagtacattgatgaagtctggaaggac
aaggctccattgcttccctacgatccttaccaaagagctcaagcgaggttctgggtcgat
tttattgacaagaagatgtacgatacttcgaggaagacatgggccacaaagggagaagag
caggaggcagcaaagaaggagttcatcgaagttctgaagaccttggaaggggagcttgga
gacaagccttttttcggaggagacaactttgggtatgtggatttgtgtttgatcccgtac
tattgttggttttattcgtatgagacatttggaaagttcagcgttgaggctgagtgcccc
aaattcattgcttgggtgaagagatgcttgcagagagagactgttgccaaggcacttcct
gatgagaaaaaagtgtttgaatttgtttcagtgttgagggaaaaaattagagttgagtaa

DBGET integrated database retrieval system