KEGG   Celeribacter indicus: P73_3952Help
Entry
P73_3952          CDS       T03575                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cid  Celeribacter indicus
Pathway
cid00620  Pyruvate metabolism
cid00680  Methane metabolism
cid01100  Metabolic pathways
cid01120  Microbial metabolism in diverse environments
cid01200  Carbon metabolism
Module
cid_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cid00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    P73_3952
  Energy metabolism
   00680 Methane metabolism
    P73_3952
Enzymes [BR:cid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     P73_3952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJE48667
UniProt: A0A0B5E8P2
LinkDB All DBs
Position
4055049..4057769
Genome map
AA seq 906 aa AA seqDB search
MTRSLENLRPPGPLLSEFEAGTPPATGAEAVLRACFLDVAGRQVAGLAALISGETPVAAV
PRHTRFAALQAVGAWHQLRAIAQEFEAMRHRREVERLSGAAAIPGSFAQVLTEASRGGYS
PAKIGKAVGSLRIAPTMTAHPTETKRVTVLEIHRRIYRRLTDLLTRHWASSEEAGYRDAL
AAEVELLWLTGELRLEKPSVAQEVAWGLHFFDQVLFAALPTLHDTLQAALPEGTGDALPD
RFLRFASWIGGDRDGNHHVTAEVTRQALESCRRAALASYRPLLAELGRDLSVGESVAALP
DWFGPRLAAQIEACGADADRLRDRNPGEPFRQYANALLYRLEATMGQNGAVPFSDPRHLA
ELLGELCAALEAAGGARIARRKVVPLLRRVRAFGFHAVALDIRQNVTVINRAVAELLGTT
PKDPRWSERLGCAFREAVPDLSVRDGLSEETRETITLFRLIAEVRQRDREALSTFVLSMT
TSAEDILAAYLMAHWCSAAPGAATDAVPPIQIVPLFETIDDLRAAPGILEKLLSQRLVLR
AVRDNGGCQEIMLGYSDSNKDGGFLTSNWELSRAQTALHRVAARHRVRLRFFHGRGGSVS
RGGAPASRAIAAQPAGTVDGQLRVTEQGEIVSAKFANRGTALGNLEYLAAAVLSHTLGLP
ARTRDAAPPVEQDEAFEALSGVSHVAYLNLVRMPGFADYFHEASPVDELGLLKIGSRPAR
RFAGGKRDLDALRAIPWVFAWSQNRHMLTGWYGIGSAMRAFTDVRGAEGWSVLHMMFERS
PLFRLVVDEAEKLLLQSDMVIAGEYAGLVPDAALRNAVLGKVQAEHDLACHMILKLTGEA
APCCRFPLFRDRIEGSRAQMAGLHRMQVELLRDVRAAGGHEAAPKQDVDALLMTIHVIST
GLGWTG
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgacccgctcgcttgaaaacctcaggccccctggcccgctgctgtcggagttcgaagcc
ggcacccctcccgcgaccggagccgaagccgttctgcgcgcgtgtttcctcgatgttgcc
ggccgacaagtcgccgggcttgccgcgctgatctccggcgagacgcccgtcgccgccgta
ccgcgccacacgcggttcgccgcccttcaggcggtgggtgcctggcatcagcttagggcc
atcgcccaggaattcgaggcgatgcgccatcgccgcgaggtcgagcgtctttccggcgcg
gcagccattccgggcagctttgcgcaggttctgaccgaggcctcgcgcggcggatacagc
ccggcaaagatcgggaaagccgtcgggagcctgaggatcgcaccgaccatgacggcacat
ccgaccgagaccaagcgcgtgaccgttctggaaattcaccgccggatctaccgccgcctg
accgatctgctgacacgtcactgggcgtcctcggaggaagccggctaccgggacgcgctc
gccgccgaggtggaactgctctggctgaccggagagctacggctggaaaaaccctccgtc
gcacaggaggtcgcgtgggggctgcatttcttcgatcaggtgctcttcgccgccctgcca
acgctgcacgacacgttgcaggctgccctgccggagggtacaggggatgccctgcccgat
cgcttcctgcgcttcgcctcgtggatcggcggtgaccgggacggcaaccaccatgtgacg
gcggaggtgacacggcaggcgctggaaagctgccggcgggcggcgctcgcctcctatcgt
ccgctcctggccgaactcgggcgcgacctgtcggtcggtgaaagcgtcgctgcgctgccc
gactggttcggcccgcggctggctgcacagatcgaagcctgcggcgccgatgccgacagg
ctccgcgaccgcaatcccggcgaacccttccgccaatatgccaacgcgctgctgtaccgg
ctcgaagccacgatgggccaaaacggcgccgtgcccttctcggatccccggcatctggcc
gagttgctgggcgagctttgcgcggcgctggaggcagcgggcggcgcgcgcatcgcccgc
cgcaaggtcgtgccgctgctgcgccgcgtgcgggccttcgggttccacgccgtcgcgctt
gacatccgccagaacgtcacggtcatcaaccgcgcggtggccgaactgctcggcaccacg
ccgaaggatcctcgctggagcgaacgcctcgggtgcgcgttccgggaggcggttcccgac
ctctccgtccgggacgggctgtcggaagaaacgcgcgagacgatcacactcttccggctg
atcgccgaggtacggcagcgcgaccgcgaggcgctgtcgaccttcgtgctgtcgatgacc
acctccgccgaggacatccttgccgcctatctcatggcgcattggtgcagcgcagcaccg
ggcgcggcaaccgatgccgtgccgccgatccagatcgtgccgctgttcgagaccatcgac
gacctgcgcgccgcaccgggcattcttgaaaaactgctgtcgcagcgcctcgtcctgcgc
gccgtgcgtgacaacggcggctgccaggagatcatgctcggctattccgacagcaacaag
gacggcgggtttctcacctccaactgggaattgtcgcgggcccagacggcgctgcacagg
gtggcggcacggcatcgcgtgcggctgcgcttcttccacggtcgcggcggttcggtcagc
cggggcggcgcaccggcgagtcgggccatcgccgcgcagccggccgggacggtcgacggc
cagttgcgggtgaccgaacagggcgagatcgtgtcggcaaagttcgccaaccggggcacc
gcgctcggcaatctggaatatctggctgcggcggtcctgtcgcacacgctcggcctgccg
gcccggacacgggacgccgcgccgccggtcgagcaggacgaggcctttgaagccctgtcg
ggggtgagtcacgtggcctatctcaacctcgtccggatgccggggttcgccgattatttc
cacgaggcgagcccggtggacgaactgggcctgctcaagatcggttcgcgaccggcgcgg
cgttttgccgggggcaaacgcgacctcgacgcactgagggcgatcccgtgggtcttcgcc
tggagccagaaccgccacatgctgaccggctggtacggcatcggctcggccatgcgggcc
ttcaccgacgtgcgcggcgccgagggctggtccgtcctgcacatgatgttcgaacgctcg
ccgctgttccggcttgtcgtggacgaggcggaaaagctgctgttgcagtccgacatggtg
atcgcgggggagtacgccgggctggtgcccgacgcggcgctgcgcaacgccgtactgggc
aaggtccaggccgaacatgacctggcctgccacatgatcctgaagctgacgggcgaggcc
gcgccctgctgccgctttccgctcttccgggaccgcatcgagggatcgcgcgcacagatg
gcggggctgcaccgcatgcaggttgaactgctgcgcgacgtgcgcgccgccggcgggcac
gaggccgcgccgaaacaggatgtcgacgcgctgctgatgaccatacacgtcatatccacc
ggtctgggttggaccggctga

DBGET integrated database retrieval system