KEGG   Citrobacter sp. FDAARGOS_156: AL515_00400Help
Entry
AL515_00400       CDS       T04313                                 

Gene name
malS
Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cif00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AL515_00400 (malS)
Enzymes [BR:cif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AL515_00400 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
92933..94963
Genome map
AA seq 676 aa AA seqDB search
MKLAAVALALIPGIAIASSWTSPELPTFEAEGTGKFVSHAALTKGTRPLILNFDQQCWQP
ADAIKLNQMLSLKPCEGAPPQWRLFKDGDYTLEVDTRSGTPTLMLSVKNAAEPATVQIRQ
CPKWDGSPLTLDVSQTFPEGAVVRDFYSQQTATVKNGSITLQPAATSNGLLLLERAETDA
PAAFDWHNATVYFVLTDRFVNGNPSNDHSYGRRNDGMQEIGTFHGGDLRGLTSKLDYLQQ
LGVNALWISAPFEQIHGWVGGGAKGDFPHYAYHGYYTQDWTTIDANMGNEVDLRALVDGA
HQRGIRVLFDVVMNHTGYATLADMQEYQFGALYLSGDELKKTLGERWTDWKPAAGQSWHS
FNDYINFSDKAGWEKWWGKNWIRTDIGDYDNPGFDDLTMSLAFLPDLKTESATPSGLPNF
YQHKPDTHAKAIAGYTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVELPAWQQLKTQASAA
LVEWKKANPDKALDDKPFWMTGEAWGHGVMQSDYYHHGFDAMINFDYQEQAAKAVDCLAN
MDLTWQQMADKLQDFNVLSYLSSHDTRLFREGGDKAAELLLLAPGAVQLFYGDESARPFG
PTGSDPLQGTRSQMNWQDVSGKSAASVAHWQRISQFRARHPAIGAGKQTTLTLKQGYGFI
REHGDDKAMVVWAGQP
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgccgccgttgcgctggcgctgatacccggcattgccatcgcctcatcatgg
acttctccagaacttcccaccttcgaagcggaaggtacgggtaaattcgtcagccatgca
gcgttgacgaagggtactcgccctttaatcctgaattttgaccaacagtgctggcagcct
gctgatgcgataaaactcaaccagatgctgtcgctaaaaccgtgtgaaggcgcgccgccg
cagtggcgtttattcaaagacggcgattacacgctggaagtcgatacccgctccggcacg
ccgaccctgatgctctcagtcaaaaacgccgcagagcccgccaccgtccagattcgccag
tgcccgaaatgggatggttcgccgttaacactggacgtgagccagactttcccggaaggc
gccgtggtgcgcgatttctacagtcagcaaacggcaacggtgaaaaacgggtcgattacc
ttacagcccgccgcaaccagtaacgggctattgctgctggaacgggcagaaaccgatgcc
cccgccgccttcgactggcataacgccacggtatatttcgtcctgacggaccgctttgtg
aatggtaatccgagcaacgaccacagctacggacgtcgcaacgatggcatgcaggaaatt
ggcactttccacggtggcgatttgcgcgggctcaccagtaaactcgactacctgcaacaa
ctgggcgtcaacgccttgtggatcagcgcaccgtttgagcaaatccacggctgggttggg
ggtggcgccaaaggcgattttccccactacgcttaccacggctactacacccaggactgg
acaacgattgatgccaacatgggtaacgaagtggatctgcgtgcgctggtagatggcgca
caccagcgcggtatccgtgtcctgtttgatgtggtgatgaaccataccggctacgccacg
ttggcggatatgcaggagtatcagtttggggcgctgtacttatcgggcgatgagctgaaa
aaaacgctcggtgaacgctggacggactggaaacccgctgccgggcagagctggcacagt
tttaatgattacatcaatttcagtgataaagccggctgggaaaaatggtgggggaaaaac
tggatccgcaccgatattggcgattacgacaatcctggctttgatgacctgaccatgtcg
ctggcgttcctgcccgatctgaaaaccgaatccgccacaccttccggactgccaaacttt
tatcagcacaagccggatacgcacgccaaagccattgctggttacacgccccgggattat
ctgacgcactggctcagtcagtgggtacgtgattacgggattgacggttttcgggtcgat
accgccaaacacgtcgagcttcccgcctggcagcagctaaaaacacaggccagcgcggcg
ttagtcgaatggaagaaagccaacccggataaagcgctggatgataaacccttctggatg
accggcgaagcctggggtcacggcgtcatgcaaagcgattattaccatcacggcttcgac
gcgatgatcaatttcgactatcaggagcaggcggcaaaggccgtcgattgtctggcaaat
atggatctcacctggcagcagatggcggataaactgcaggacttcaacgtcctgagctat
ctctcctcgcacgatacgcgtttgttccgcgaaggtggagataaagccgccgagctattg
ctgctggcgccgggcgcggtacaactcttttatggcgacgagtcggcacgacctttcggc
ccaaccggctcagacccgttacagggtacacgctcgcagatgaactggcaggacgttagc
ggaaaatctgccgccagcgtcgctcactggcagcgcatcagtcagttccgagccagacat
cccgccattggcgccggtaaacagaccacgctgacattgaagcagggatacggatttatc
cgcgaacatggcgacgataaagccatggtggtgtgggccggtcaaccctga

DBGET integrated database retrieval system