KEGG   Citrobacter sp. FDAARGOS_156: AL515_06590Help
Entry
AL515_06590       CDS       T04313                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cif  Citrobacter sp. FDAARGOS_156
Pathway
cif00730  Thiamine metabolism
cif00790  Folate biosynthesis
cif01100  Metabolic pathways
cif02020  Two-component system
Module
cif_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cif00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AL515_06590
   00790 Folate biosynthesis
    AL515_06590
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AL515_06590
Enzymes [BR:cif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AL515_06590
Exosome [BR:cif04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL515_06590
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cif00537]
 Enzymes
  AL515_06590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: AMH13540
LinkDB All DBs
Position
1423597..1425012
Genome map
AA seq 471 aa AA seqDB search
MKQSALAIALLPLLFTPVIHAETSTVAAMDNRAAQGDITTPGGARRLTTDQTAALRDSLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHEKDHATILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTAEKCPTNALEKGGKGSITEQLLNARADVTLGGGAKTFAETAAAG
EWQGKTLREQAQARGYQMVSDTATLAAITEANQDKPLLGLFSDGNMPVRWEGPKASYHGN
LDKPVVTCTPNPKRNDTVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALAFAKKDGNTLVVVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VISYGNSEEESQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcgcactcgctattgccctgttacccttgctgtttaccccggttattcat
gcagaaacatctaccgtagcggctatggataatcgtgccgcacagggagatatcaccaca
ccgggtggcgcgcgtcgattaacgactgatcaaacggcagcactacgagattctttgaac
gataaaccggccaaaaatattattttattgatcggtgatggtatgggggactcggaaatt
accgctgcgcgaaattatgcagaaggcgccggtggtttttttaaaggtattgatgcgtta
cccctgaccggacaatacacgcactacgcgttggataaaaaaacgggtaaacctgactat
gtgaccgattccgcagcctctgcgacggcatggacgaccggtgttaaaacatataacggt
gcgctgggcgttgatattcacgaaaaagatcacgccactattctggaaatggctaaagct
gccggtctggcgacaggcaacgtatccactgctgaattgcaggatgccacccccgccgcg
ctggttgcgcatgtgacgtcgcgtaaatgttacggaccgagcgtcaccgctgagaaatgc
ccgacgaatgcgctggaaaaaggcggtaaagggtcaatcaccgaacaattattgaatgcc
cgcgctgacgttacgctgggcggcggggcaaaaacctttgctgagaccgcagctgcgggc
gagtggcaggggaaaacgctgcgtgaacaggctcaggcccgtggctatcagatggtcagt
gataccgcgacgctggcagccattaccgaagcgaatcaggataaaccgctgttaggtttg
ttctctgacggcaacatgccggtacgctgggaagggccaaaagcgtcttaccacggtaac
cttgataagccagtcgtgacctgtacgccaaatccaaaacgtaacgacacggtgccaacg
cttgcccagatgacggataaagcgattgagctattaagtaagaatgaaaaaggctttttc
ctgcaggtagaaggcgcgtccatcgataagcaggatcacgccgcaaacccgtgcggtcag
attggtgaaacggtcgatctggatgaagctgtacagcgcgcgctggccttcgcgaagaaa
gacggcaacacgctggttgtcgtgaccgctgaccacgcgcatgccagccagattgttgcg
ccagacaccaaagcccctggcctgactcaggcgctgaataccaaagatggtgcggtgatg
gttatcagctatggcaactcggaagaggaatctcaggagcataccggcagccagctgcgc
attgctgcctatggcccgcatgcggcgaatgtggtaggcctgaccgatcagactgacctg
ttttacaccatgaaagcggcgttaggtctgaagtaa

DBGET integrated database retrieval system