KEGG   Chryseobacterium sp. IHB B 17019: ATE47_05245Help
Entry
ATE47_05245       CDS       T04193                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cih  Chryseobacterium sp. IHB B 17019
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cih00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATE47_05245
  Energy metabolism
   00680 Methane metabolism
    ATE47_05245
Enzymes [BR:cih01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ATE47_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1148244..1150778
Genome map
AA seq 844 aa AA seqDB search
MIHDQRAEKFRQIVENKFQIYNSLFMSLPYDKMTNIGMLLPFLGEESKVGYEAGKTPEEI
IEEFFKNHTDLQTEEQKLELLFKIIQYIERQVVLFDSIEDAAFPNLHSESDNGTVTNMFE
RSLQDHKLEKVREKLKDFTVKVVFTAHPTQFYPSSVQRIIHDLRSAITTDSITNIDMLLQ
QLGKTPFVNKEKPTPIDEALSIISYLRNVYYDSIGELFTKIKRTFGNGNFHLHEDLIQLG
FWPGGDRDGNPFVTADVTKRVAEELRSAILKSYYSHLKFVRRRLSFRGVAEALNALSDEL
YSSIFNGKKITVEDILKRADEAEKILVEQHNSLFLDLLVNFKDRVKIFGTHFATLDIRQD
SRIHQKVVDEVFVKICGNVEATYEDKFNKLIQITNKVNADEFEDIVKDTLLTVSQVSEIQ
ELNGLRGMNRYIISNSDAVKDVMNVYAFFKVCGYKDEEINMDIVPLFETMEGLANAENVM
NALYQNPIYKKHLERRGNQQTIMLGFSDGTKDGGYLKANWEIYKAKELLTQLSIQNGIKV
IFFDGRGGPPARGGGKTHDFYASQGRTIANNKIELTIQGQTITSIFGNKEQAKYNFEQLL
TAGVENDVFKNSKKDLTEKERALIIELAEISYQKYSDLKAHPMFVPYLQEMSTLEYYGKT
NIGSRPSKRGDGNELKFEDLRAIPFVGSWSQLKQNVPGFFGFGFAMQKMKEEGRFDEVRE
LYKGSDFFKTLVLNSMMSMNKSYFPLTYYIKNNPKFGAFWDVLFDEYQLSKDIMLELTGF
TMLQQEDPLSRKSVKIRERIVLPLLSIQQYALMKIQKGEGNKEAYEKLVTRSLFGNINAS
RNSA
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgatacacgaccaacgcgcagaaaaattcaggcagatcgtggagaataagttccagatc
tacaattcattgtttatgagcctgccttatgataaaatgacgaatatcgggatgctgctc
ccgtttcttggggaagaaagtaaagtcggttacgaagccggaaaaacgcccgaagaaatc
attgaagaattctttaaaaaccataccgatctgcagaccgaggaacagaagctcgaactg
ctttttaaaatcatacaatatattgaaagacaggttgttttgttcgacagtattgaagat
gctgcattcccaaaccttcattctgaaagtgacaacggaacggttaccaatatgtttgaa
cgttccctgcaagaccataaactcgagaaagttcgtgaaaaactgaaagattttacagta
aaagtggtttttacagcacacccgacgcagttttatccgagttctgtccagagaattatc
catgatttgagaagtgcaatcacaacagattctatcacaaatattgatatgctgttgcag
cagttaggaaaaacaccgtttgtcaacaaagaaaaaccaactcccattgatgaggcgtta
agtatcatttcttaccttagaaatgtttattacgattcgattggtgaactgttcacgaaa
ataaaaagaacatttggaaacgggaattttcatttgcacgaagatcttatccagctcggt
ttctggccgggtggtgacagggacggaaatccttttgtaacggctgatgtgacgaaaaga
gtggcggaagaacttcgttccgcgattttgaaatcttattacagccatttgaaatttgtc
agaagaagactaagtttcaggggtgttgccgaggctttaaatgctttgagcgatgagctg
tattcttcgattttcaacggaaagaaaattacagttgaagatattctaaaaagagccgat
gaagcggaaaaaattcttgtcgagcaacataattccttattccttgatctgctggtgaat
tttaaagatcgtgtgaagattttcgggactcattttgccacattggatatccggcaggac
agcaggattcatcagaaagttgttgatgaggtttttgttaaaatctgcggaaatgttgaa
gcaacttacgaggataagtttaataaattaattcaaatcacaaacaaggttaatgccgat
gaatttgaagatatagttaaagatacattattgacggtttcccaggtttcagaaattcag
gaattgaatggtttgagaggaatgaaccgttacattatttccaattccgatgcggtgaaa
gacgtgatgaatgtgtatgcatttttcaaggtttgcggatataaggatgaagaaattaat
atggatattgttccgctttttgagacgatggaaggccttgctaatgctgaaaatgtgatg
aatgcattgtaccagaacccgatttacaaaaaacatttggaaagaagaggaaaccaacag
acaattatgcttggtttttcggacgggacaaaagacggcggttacctgaaagccaactgg
gaaatttataaagccaaagaacttttaacccaactttccatacaaaacggaattaaagta
atctttttcgatggtcggggcggacctcccgcaagaggtggcggaaaaacccacgatttc
tatgcttcacagggaagaacgattgctaataataaaattgagttaactattcagggacag
acgattacaagtattttcgggaataaggagcaggcaaaatacaacttcgaacagcttttg
acggccggagttgagaacgatgttttcaaaaattctaaaaaagatttaacggaaaaagaa
agagctttaattattgaattagccgaaataagctatcaaaaatattcagatttaaaggct
catccgatgtttgttccttaccttcaggagatgagcacattggaatattacggaaaaacc
aatatcggaagccgaccatcgaaaagaggggacggaaacgaattaaaatttgaggattta
agggcaattccgtttgttggttcatggtctcaattgaagcaaaatgttccgggattcttc
ggttttggttttgcgatgcagaaaatgaaagaagaaggaaggtttgatgaggtaagggaa
ttatacaaaggctcggatttctttaaaacgctggttctgaactcgatgatgagtatgaat
aaatcttattttccattgacttattacattaaaaataatccaaaattcggggctttctgg
gatgttctattcgatgaatatcagctttctaaagatattatgctggaattgacgggcttt
accatgcttcagcaagaagatccgctatcaagaaaatcggtgaaaatccgtgagagaatt
gtacttccgctgttgagtattcagcaatatgctttaatgaaaattcaaaaaggagaagga
aataaggaagcctatgaaaagctagtgacgcgttctttgtttggaaatattaatgcgagt
agaaattcagcttaa

DBGET integrated database retrieval system