KEGG   Coccidioides immitis: CIMG_09002Help
Entry
CIMG_09002        CDS       T01114                                 

Definition
(RefSeq) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cim  Coccidioides immitis
Brite
Translation factors [BR:cim03012]
 Eukaryotic Type
  Elongation factors
   CIMG_09002
 Prokaryotic Type
   CIMG_09002
Mitochondrial biogenesis [BR:cim03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CIMG_09002
Exosome [BR:cim04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CIMG_09002
  Exosomal proteins of breast cancer cells
   CIMG_09002
  Exosomal proteins of colorectal cancer cells
   CIMG_09002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 4558700
NCBI-ProteinID: XP_001239381
UniProt: J3K1F1
LinkDB All DBs
AA seq 439 aa AA seqDB search
MSNISRSLNVLLRTSRISLQRPRAVNPVQHVFARDRLVARGMATAFERTKPHVNVGTIGH
VDHGKTTLTAAITKRQAEKGMASFLEYGAIDRAPEERKRGITISSSHIEYQTDNRHYAHV
DCPGHADYIKNMITGAANMDGAVVVVAASDGQMPQTREHLLLARQIGIQKIVVFVNKVDA
IEDKEMLELVELEMRELLTSYGFEGEETPIIFGSALCALEGRQPEIGVTKIDELLQAVDT
WIPTPQRETDKPFLMSIEEVFSISGRGTVVSGRVERGILKKDSEVEIVGGSPEPIKTKVT
DIETFKKSCDESRAGDNSGLLLRGVKREDISRGMVVAVPGSVKAHTEFLVSLYVLTEAEG
GRKSGFSSKYRPQMFIRTADEAAQLSWPGEDQDKMAMPGDNIEMICTTLHPVAAEAGQRF
NIREGGRTVATGLVTRVIK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacatttctagatctctcaatgtccttctcaggaccagcagaatctctctgcaa
agaccgagagccgtcaatcctgtccaacatgtcttcgctcgagacagactggttgctcgg
ggcatggcgaccgccttcgagagaaccaagccccacgtcaatgttggcaccattggtcac
gtcgatcacggaaagacaaccttgaccgcagccatcaccaagcgtcaagcagagaagggc
atggccagcttcttggaatatggtgcaattgacagggctcctgaggagagaaagcgtggt
atcactatctcttcttcgcacatcgaataccagacagacaaccgacactatgcccacgtc
gactgccctggacacgccgattacattaaaaacatgattactggtgcagccaacatggat
ggcgcagttgtcgtcgttgctgcttcagacggtcaaatgcctcaaactcgagagcattta
cttctcgcccgtcagatcggtatccaaaaaatcgtcgtcttcgtgaacaaggttgatgcc
atcgaggacaaggagatgttggagcttgttgaattggagatgcgtgaactcctaaccagc
tacggttttgagggtgaagaaactcccatcatttttggctctgctctctgtgccctcgaa
ggaagacaacccgagatcggtgttaccaagattgatgagctcttgcaggccgtcgacacc
tggattcccactcctcagcgtgagactgacaagcccttcttgatgtccattgaggaagtg
ttctctatttccggacgaggaaccgttgtctccggccgtgtggagcgtggtatcctcaag
aaggactccgaagttgaaattgtcggcggttcgcccgagccaatcaaaaccaaggttacc
gatatcgaaacctttaagaagtcttgcgacgagtctcgcgctggtgataactccggcttg
ctcctacgaggcgttaagcgtgaagatattagccgtggcatggtcgtcgctgtcccaggc
agtgtcaaggcccatactgaattcttagtttcgctttacgtccttaccgaagctgagggt
gggcgcaaatctggattcagcagcaagtaccgcccacagatgttcattcgcactgccgac
gaagccgctcagctcagctggcccggagaagatcaagacaagatggctatgccaggagac
aatatcgaaatgatttgcaccaccttgcacccagttgccgccgaggctggccagcgattc
aacattcgtgaaggtggaaggaccgtcgctactggccttgtcacccgtgtcattaaataa

DBGET integrated database retrieval system