KEGG   Ciona intestinalis (sea squirt): 100187387Help
Entry
100187387         CDS       T01056                                 

Definition
(RefSeq) glutathione S-transferase 1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00480  Glutathione metabolism
cin00980  Metabolism of xenobiotics by cytochrome P450
cin00982  Drug metabolism - cytochrome P450
cin00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100187387
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100187387
   00982 Drug metabolism - cytochrome P450
    100187387
   00983 Drug metabolism - other enzymes
    100187387
Enzymes [BR:cin01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100187387
Transporters [BR:cin02000]
 Other Transporters
  Pores ion channels [TC:1]
   100187387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_C_3 GST_N_2 GST_C_2 GST_C_6 DUF5087
Motif
Other DBs
NCBI-GeneID: 100187387
NCBI-ProteinID: XP_002125923
Ensembl: ENSCING00000009904
UniProt: A0A1W2WB26
LinkDB All DBs
Position
5
AA seq 239 aa AA seqDB search
MGNGNAKAQISQQQQQPQRGPVTFYSSVFSPPCRGLWMVLKASGVDFILKETDILSGEHK
KPEYLAVNSLGTVPALKDGNLCIGESRAIMQYVCNRYAAGSALSLYPKDPAARAVVDQVL
YFDTSLITAVYKYTKIAEVLFKHEKHLELDGKDEMKKKLLSLENFLSKNRYLAGDHMTIA
DLSVLANLVVLDICHFDDYEDFPKLKEWMKTMKALPYFEACCGKHNKAMTEMYQKVLHE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgggaacgcaaaagcgcaaatcagccaacagcaacaacagcctcagcgaggt
ccagtcactttttattccagtgttttcagtccaccatgccggggtctttggatggtactg
aaagcatcaggggttgactttatcctaaaggagactgacattttaagcggcgagcacaaa
aaaccggaatatttggcagtaaattcattgggaactgtccctgccttgaaagacgggaat
ttgtgcatcggcgaaagtcgtgctatcatgcaatatgtgtgcaaccgatatgccgctggg
tctgctctcagtctttatcccaaagatcccgctgctcgtgcggttgtggaccaagtttta
tacttcgacacctcgcttattacagcagtgtacaaatatacgaaaatcgcggaagttctt
ttcaagcatgaaaaacacttggaactggatggcaaagacgaaatgaaaaagaaacttctt
tcattagaaaacttcttgtctaagaatcgttaccttgctggagaccacatgacaattgca
gatttatctgttttggcgaatttggtggtgttggatatctgtcactttgatgactacgaa
gactttcctaaactgaaagaatggatgaaaacaatgaaggctcttccatacttcgaagct
tgctgtgggaagcataacaaagctatgaccgaaatgtatcagaaagttttacatgaataa

DBGET integrated database retrieval system