KEGG   Chryseobacterium indologenes: CEQ15_15855Help
Entry
CEQ15_15855       CDS       T04932                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cio  Chryseobacterium indologenes
Pathway
cio03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cio00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CEQ15_15855 (ligD)
Enzymes [BR:cio01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CEQ15_15855 (ligD)
DNA repair and recombination proteins [BR:cio03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CEQ15_15855 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 mRNA_cap_enzyme DNA_primase_S HD
Motif
Other DBs
NCBI-ProteinID: ASE62859
UniProt: A0A1Z3W4Z7
LinkDB All DBs
Position
3522098..3523975
Genome map
AA seq 625 aa AA seqDB search
MLAKLSGEAFNDKDWVFEIKWDGYRAIADLSHKQPLFYSRNGISFLSKFKIITTDFDRQK
YQMILDGEVVAYDHEGRPNFQLLQQIGDNPGLALVYQVFDILWLNGHSTEELPLLQRKEL
LKEALVETDVIKYCDHIPEKGIDFFEQMKKMQLEGMIAKRADSLYVENHRTSDWLKIKFT
NTEEAIICGFTEPRGSRKSFGALILGNYIDGRLTYCGHTGTGFNNNSLQELYERLHPLIM
KTSPFETIPKTNMPVTWIKPELVCEIKYSEITKDGIYRHPVFIAIREDKEPEDIVNTVHE
HTEKFKNMKAKTSSKKAETHEKEKEITLNKHIVKLTNQDKVYFPKDGITKGDVIAYYQSV
ATYILPHLKNRPLSLNRFPNGIEEQSFYQKDAGEHIPDWIKTTQVYSESNDKYIDYIYCN
DKATLAYLNNLGCIDLNPWNSSLPDLEHPDYLVLDLDPSKKNTFDDVIETALQVNEVLNS
IKIKGYCKTSGSTGIHIYIPMGGNYDFDQVKDFAHILMKQVNERLPKITTLERSLQKRDS
NKIYLDYLQNRTGQTLASAYSLRPKEGASVSMPLDWEELKQGIRPADYNIHNSLERIKEK
GDLFKPVLGKGIDMMKALELLQNID
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgctagctaaactttccggcgaagcctttaatgataaagactgggttttcgaaataaaa
tgggatggttaccgtgccattgcagacttaagccacaaacaaccactcttctactcccgc
aacggcatttcctttttatcaaaatttaaaatcattaccactgattttgaccggcagaaa
tatcaaatgatccttgatggggaggtggtggcctatgatcatgaagggcgaccaaatttc
cagcttttacagcaaattggggataatcccggcctggcacttgtttaccaggtttttgat
attttatggctaaacggccattctacggaagaacttcctttacttcaacgtaaagaatta
ttgaaagaagcactggtggaaaccgatgttattaaatattgtgatcatattcctgaaaaa
gggattgacttctttgaacaaatgaaaaaaatgcaactggaaggaatgattgccaagcgt
gcagacagcctgtatgtagaaaaccatagaaccagtgactggcttaaaattaaatttacc
aatacggaggaagccattatttgtggatttaccgagccacgaggttcaagaaaaagcttt
ggtgcgttgatcctggggaattatattgatggcagactgacctattgcggacataccgga
acaggattcaacaacaattcgcttcaggaactttatgagaggcttcatccactcatcatg
aaaacttcaccttttgaaaccattccgaaaaccaatatgcctgttacgtggattaaaccg
gaactggtttgcgaaataaaatactctgaaattacaaaagacggtatctacagacatcct
gtttttatagcgatacgagaggacaaagaaccggaggatattgtaaatactgtacatgaa
cacaccgaaaaatttaaaaatatgaaagctaaaacttcttcaaaaaaagcagaaactcat
gaaaaagagaaggaaatcactttaaacaaacatatcgtcaaactgaccaatcaggataaa
gtttatttcccaaaagacggtattacaaaaggagatgtaattgcctattatcaatcggtt
gctacctatattttaccgcatttgaaaaacagaccactttctctcaatcgttttcctaat
ggaattgaagaacaaagcttttatcaaaaagatgcgggtgagcatattccagactggatc
aaaacgactcaggtgtattccgaatcgaatgacaaatacattgattatatatattgtaat
gataaggctactttggcctatctgaataaccttggatgtattgatcttaacccctggaac
agctcgttgcctgatctggagcaccctgattatctcgttttagatttggatccgtcgaaa
aaaaacacatttgatgatgtgattgaaacagctctccaggtcaacgaagtattaaattct
ataaaaataaagggatactgcaaaacttccggaagcacaggaattcacatctatatcccg
atgggagggaattatgactttgaccaggtaaaagattttgcacacattctcatgaaacag
gtgaatgaaagacttccgaaaattacaacacttgaaaggagtttacagaaaagagactcc
aataaaatataccttgactacctccaaaacaggacaggacagacattagccagtgcttac
agtctaagacccaaagaaggggcttcggtttccatgcctttagattgggaagaacttaag
cagggtatcagacctgcagactataatattcataacagcctagaaagaattaaagagaaa
ggagatttattcaaacctgtgctgggaaagggcattgatatgatgaaagcattggaactg
cttcagaacattgattaa

DBGET integrated database retrieval system