KEGG   Citrus sinensis (Valencia orange): 102624482Help
Entry
102624482         CDS       T02983                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2
Organism
cit  Citrus sinensis (Valencia orange)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
3
AA seq 2483 aa AA seqDB search
MGSCENLTSVDEPSCNSVFEQHSSLKFMEEPVSEQRMCLKTRFDVLDANVSGSTKLDGRL
GLSIDDTTHCVSCGDAGDTGIGNKDGLIDEFQNVVGVSLEKAIDDECGVSRVCFIESQEE
IGVCSSPGRCLDLSQDGNNSYVSSAYVTEAVVGDRDGSVSKCDNVSGSGLEKLVDESQSK
VDSEAVVGDRDGPASECNNVSGLVLEKLVDEEQGVCLDGSQSEVDVCGNGLCVEKGGFQG
EDLESFKHQKLPLGEVPSNCSPRNCDRRDKQKDDQGFNRSSVEETVEVTGVETNALAEVK
LGNDNQTLSSDAYEMPLKSIPVGGLTRNCVQQHGQKGDNILSCLPGEEGVMIKKSDELAE
LEKVPCDLIMPFGSFGIPLTGSPRNFVQHGDQKDGRTVSCSSSEGDMEGKEVKTDALDEI
EKVNCFQISPSQFCEMPPELLPFTGSPNNSVQQEDQKNDNTAGCTSSEGDMECIEEKTDA
LSGKMKVTCDQMLPSQCCEMDSEAISLVDSPTDCVQLGNQENNKNGGSLSSKSAKEVIED
KMGTCGQILPSQGCSMTPELIPKTDSLRNCTQQNEQKSNECICVPSLEEEGKNYASLGIE
IDICGHMLSFQECEIRSESTLVTEKQLIVEAKRDIVHGLENDSGHPRSPLEHTEPRMEFA
SATDLSFRCIQKKEQQGIESLAEGKANLSAAVEANMWKANLAAAVEANMCNCISASQDGE
TPFKVFYEDDLMRTCEGHKDHVDHESIGHLAVGTVEQKDNTDTCILALPMQSCQSSLESL
RIADSLSNCSQQNDQGNNKSVDGLSAESATEAVEEKSDVTTDIKVEICSQLSPIEENEKE
HSSRVIEKPISLQSCQPFAVDENGSCKSLNVAGLSQKDGFGAISSSGAVDGFGQINHEVK
DDVGTNCFSETKYPNRVSLSSRRSSRISRSSQKTQTKRAARNCRTKAKIQHSHGSIDIIL
NIARRKRSCLSKPARSSIWGLLGSITQIFGKSGMSSFNLSQNQGSQKARGDHRSQKRNKI
QASGSSLTPSKKWNVSTRCLRLKVKVGKEICQSTLNVVVPKVADTMGSNDIVVGDDISES
YPTKNSEFPILAHEDEDIFGEEGTQRQFQCLDSNPEEVVKHPGNSILDVHFASQELKATV
ITDNAAGDVADGNSAHKGVGILGGASESNYVDPGTSPDSEVINTAPDSEVGTRSKEGSHK
VVLTSSEIFAAPGNVTSSRRGKKKTNLLFAGNCSLHDDSPVAASKVKPPKKRGGRQKLED
GSHSSDSLVAFPVTYASSNSSSGKEFCGELLPSSRDSEPGIIEEAMVPSVKCKGSELSKS
LKSGGRKKGRSKVSNSAKSRRRKASTQRGNQRKSVNKNEVKEKGVLAAKRRDEGVLELVE
EKTEVRPQIGSHIADDIGKTDSGNNSMSVDVSNAEITSGGEPEHYCPPESAWVRCDDCYK
WRRIPVSVADLIDENCRWVCKDNMDTTFADCSIPQEKTNADINAELGLSDYEEEDGLINY
NTSGKGLDFQSTPGSSFRRIDSNVFLHRSRKTQTIDEVMVCHCKPPLDGRLGCRDECLNR
MLNIECVQGTCPCGDLCSNQQFQKRKYAKMQWRPCGKKGYGLESLEDILTGKFIIEYIGE
VLDMQAYEARQKEYAANGHKHFYFMTLNGSEVIDACAKGNLGRFINHSCDPNCRTEKWLV
NGEICIGLFAMRDIKEGEELTFDYNYVRVFGAAAKKCHCGSPQCRGYIGGDPLNTEIIYQ
GDSDEEYPEPLMLEDGETGDGFKTMSRTSPFYGDRTQISEAIAEDTNKMDDSATAVGQLE
ISGNVNDSKSQSIPVIPQLLHSLEREDSKGKCPLLQSLETSLVVENESSIPVSSVQQKET
MNKTSSVIPQVETSLPALISGNLFTDGSDAGRKSKSDIVEDNQSLPKSHPRIKTSRKSGS
IKKGKVDGSPLSGNKVKSVASKSQVFFIKPKKIMEGSSNGRFEAVQEKLNELLDAEGGIS
KRKDAPKGYLKLLLLTAASGGSGNGESIQSNRDLSMILDALLKTKSRVVLMDIINKNGLQ
MLHNMIKQYRRDFKKIPILRKLLKVLEYLAVREILTRNHITAGPPCPGMESFRGSILSLT
EHDDKQVHQIARSFRDRWIPKPFRKHSYKDRDDSGMDIHRVANCNRLPMLHNHRRDESLR
PSEAIDCVMQSLVAKTSVDSAANEAGSSPGAGGCQTNGPKVRKRKSRWDQPAETNLDSIK
HKKLMLESRVLPSREDINCPDHIHNHCNKDEAVSSEDGGQITQEDVPPGFSSPFNPPLVS
SDSSSTTDLSQQNVSQLRCAFDVAIAHPQGKFNSRLPVSYGIPLHILQQFGSSQAETVDS
WVIAPSMPFHPFPPLPPFPRDKKDTPPASAVSCKTIDGPAEEWQQDSNHGPSCCPDEDNP
SMTGANQSDADIPGTDGQHTFKRMRGSSNDLGKRYFRQQKRKGPPWLWRRNELRSSYCSQ
DVSCRVDKPVSSFIQRPPQQNHH
NT seq 7452 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgtgtgagaatttgacatcagttgatgaaccctcgtgtaactctgtttttgaa
cagcattcgagcttgaaatttatggaagaaccagtttctgagcagaggatgtgtttgaaa
acaagatttgatgtgcttgatgctaatgtgagtggcagtacgaagttggatgggcgtttg
ggtttgtctattgatgataccactcattgtgtgagctgtggagatgctggagatactggc
attggtaataaagatgggctgattgatgagtttcagaatgtggtgggtgtgagtttggag
aaagcgatagatgatgaatgtggggttagcagggtttgcttcattgagagtcaggaggaa
attggtgtttgtagttccccaggtaggtgtttggatttgtctcaagatggaaacaatagt
tatgtaagttctgcttatgttacagaggctgttgttggtgatagagatgggtcagtaagt
aagtgtgataacgtgtctgggtcgggtttggagaaattggttgatgagagtcagagtaaa
gtagattctgaggctgttgttggtgatagagatgggccagctagtgagtgtaataatgtg
tctggtttggttttggagaaattggttgatgaggagcagggggtttgtttggatgggagt
cagagtgaagtagatgtttgtggcaatgggttgtgtgtggagaaaggagggtttcaaggg
gaggatttggaatcatttaagcatcagaaattgcccttgggagaagtgcctagcaactgt
tcaccgagaaattgtgatcgacgggataagcagaaggatgatcaagggttcaatcgttcc
tctgttgaagagactgtagaggttacgggagtggaaactaatgctttagctgaggtaaag
ttgggcaatgataaccaaacattatcatctgatgcctatgaaatgcccttgaaatcaatt
cctgttggtgggttgacaagaaattgtgttcaacagcatgggcagaagggtgataatatt
cttagttgtctccctggggaggaaggggttatgataaagaaaagtgatgagttagctgag
ttggagaaagtgccttgtgacttgattatgccttttggaagctttgggattcccttgact
ggatcacctagaaattttgttcaacacggcgatcagaaagatggtaggactgtcagttgt
tcctcttcagaaggggatatggaaggcaaggaagtgaaaactgatgccctagacgagata
gagaaagttaactgtttccagatttcgccatcacaattttgtgaaatgcctccagaatta
ttacccttcactggttcacctaataattctgttcaacaggaagatcagaagaatgataac
actgctggttgtacctcttctgaaggggatatggaatgcatagaagaaaaaactgatgct
ttatctgggaaaatgaaagttacgtgtgaccaaatgttgccttctcaatgttgtgaaatg
gattcagaagctatatctctggttgattcacctacagattgtgttcaactgggtaatcaa
gagaataataagaatggcggttctctctcctccaaaagtgctaaggaggttatagaagat
aaaatgggtacatgtggccaaattttgccctcacagggctgttcaatgaccccagaatta
atacctaagactgattcactgagaaattgtactcaacagaatgagcagaagagcaacgag
tgcatctgtgttccatccttggaagaagaagggaaaaattatgcttcacttggaatagag
atagatatttgtgggcatatgctgtctttccaggaatgtgagattcgctcagagtcgaca
cttgtgactgagaaacaattaattgttgaagcgaagagagatattgtacatgggttagag
aatgatagtggccacccaagatcacctttagagcatactgaaccgcgcatggaatttgca
tctgcaacagacttgtcatttcgttgtattcaaaaaaaggagcagcagggcattgagagc
ttagcagaagggaaagccaatctgtcagcggctgtagaagctaatatgtggaaagccaat
ctggcagcggctgtagaagctaatatgtgcaactgcatatcagcttcacaggatggtgaa
acgcctttcaaagttttttatgaggatgatttaatgagaacttgtgaaggacataaggat
catgtggatcatgaaagcattggtcatctcgctgttggaactgtggagcaaaaagataac
actgacacatgcatcctagcattgcctatgcagagttgccagagctccttggaaagtttg
cgtatagctgattcactgagtaattgttcccagcagaatgaccaagggaataataagagt
gttgatggtctttctgcagagagtgctacagaggccgtggaagagaaaagtgatgttaca
actgatatcaaggttgagatttgcagtcagctatcaccaatagaagaaaatgaaaaggag
cactcctccagagttattgagaaaccaatttctttgcagtcatgccaaccctttgctgta
gacgagaatggctcttgtaagagtttaaatgttgcgggtctctctcaaaaagatggtttt
ggtgctattagttctagtggtgcggttgatggttttggacagatcaatcatgaagtaaaa
gatgatgtgggcacgaattgcttttctgaaactaaatatcctaacagggtatcattatct
tctagaaggagcagccgtataagtagatctagccagaagactcagaccaaaagggctgcg
aggaattgcaggactaaggccaaaattcaacattctcatgggagtattgatataatcctc
aacattgcaagaaggaagagaagctgtttgtccaaaccagctcgttcttctatctggggg
ttattgggcagcattactcaaatttttggtaagagtggcatgagtagtttcaatttatct
cagaaccaaggatcacaaaaggcaagaggtgaccatagaagtcaaaagcggaataagatt
caggctagtggaagctcattgacccctagtaaaaaatggaatgtttcaactcgatgcctt
cgtttgaaggttaaagtggggaaggaaatttgtcaaagtactctgaatgttgtggtcccc
aaggtggctgacacaatgggatccaatgatattgttgttggtgatgacatttctgagtca
taccctacaaaaaattctgagtttccaatattagcccatgaagatgaagatatatttggg
gaagagggcactcaaagacagtttcagtgtttggatagtaacccggaggaggtagtgaaa
cacccaggtaactctatcttggatgtgcactttgcaagtcaggaattgaaggccactgtg
attacagacaatgcagccggggatgttgcagatggtaattctgcccataaaggggttgga
atattgggtggagcaagtgagagcaattatgtggatcctgggacttcaccagattctgaa
gttatcaatacagctcctgattctgaagttgggactagaagtaaagaaggctcgcataaa
gttgttttgacttcctctgaaatctttgctgctcctggaaatgtcaccagcagccggaga
gggaagaagaaaactaacctcctttttgcaggtaactgtagtctgcatgacgattcacct
gttgcagccagcaaagttaaaccaccaaaaaaacgtggtggcagacagaaactggaagat
ggtagtcactctagtgattctctcgttgcatttcctgtcacttatgcttcaagtaattca
tcaagcggcaaggaattttgcggcgaactgttgccttcatcgagagacagtgaacctgga
atcattgaagaggctatggttccttcagttaaatgcaagggatctgagcttagcaaaagt
ttaaaatcgggtggaaggaaaaagggaaggtccaaagtctctaactcagctaagagcagg
agaagaaaggcttctacacagaggggaaaccaacggaagtcagtcaacaagaatgaagtc
aaggagaagggtgttttagctgccaaaagaagggatgaaggtgttttggagctggttgag
gaaaaaacagaagttcgaccacaaataggaagccacattgcagatgatattgggaaaaca
gattctggcaacaatagtatgtctgttgatgtatcaaatgcggagattacatcaggtggt
gaacctgagcattattgtcctcccgaaagtgcttgggtgcggtgtgatgactgttacaaa
tggcggcgtatcccagtttcagttgcggatttgattgatgaaaactgcagatgggtctgt
aaggacaacatggatacaacatttgctgattgttcaattcctcaagaaaagacaaatgct
gatattaacgctgagttaggcttatcagactatgaagaagaagacggccttataaattac
aatacatcaggaaagggtttggattttcagagtacacctgggtcatcatttaggcgcatt
gattcaaatgtctttcttcatcgtagtcgtaaaacacaaacaattgatgaggtaatggtt
tgccattgcaaaccacctttagatggtcggctcggctgtagagatgaatgcttgaatcgg
atgcttaacattgaatgtgttcaaggcacttgtccttgtggtgacctatgttcaaatcaa
cagttccagaaacgcaagtacgccaaaatgcagtggcgtccatgtgggaagaagggttat
ggactagagtcacttgaggatatactgacagggaaatttattattgaatatattggagag
gtccttgacatgcaagcttatgaggcacggcaaaaggagtatgcggccaatggtcataag
catttttacttcatgacattaaatggcagcgaggtaatagatgcatgtgccaagggaaat
ctgggccgtttcattaaccatagttgtgatcctaactgccgtactgaaaagtggctggtg
aatggagaaatttgtatcggactatttgcaatgagggatattaaggagggtgaagagctg
acatttgactacaactatgtcagagtgtttggggctgctgccaaaaaatgtcattgtggt
tctcctcaatgccggggttatataggtggggacccgctaaatactgaaataatttatcaa
ggtgattcagatgaggagtatcctgaacctctgatgcttgaagatggtgaaactggagat
ggtttcaagacaatgtccagaaccagtcccttttatggtgacagaacacaaatttctgaa
gccatagcagaagacacaaataaaatggatgattctgccacagctgttggacaattggag
atttctggaaatgttaatgactctaagagtcaatccattcctgttattccccaattactc
cattcattagaaagggaggattcaaaagggaaatgtcctctacttcagtcactagaaact
tctcttgtggtagaaaatgaatcaagcatacctgtatcttccgttcagcagaaggaaaca
atgaataaaacttcatctgtaatcccacaggtggagacttctttgccggctctgatatct
gggaatttgtttactgatggaagtgacgctggtaggaagtccaagtctgatattgttgaa
gacaatcaaagtttgccgaaatctcatcctcgtataaagacttctcgtaaatctggatct
attaagaaaggcaaggttgatggtagtcctttaagtggaaataaagttaagtcggttgcc
agcaaatcccaggttttctttatcaaacccaaaaagataatggaaggttcctctaatggt
cgttttgaagcagttcaggagaaattaaatgagttgctggatgctgaggggggcattagt
aaacgtaaagacgctcctaaaggctatttgaagcttctgcttttgactgctgcttctggt
ggtagtggcaatggcgaatcaattcagagcaatcgagatttatcaatgatccttgatgct
cttctgaaaacaaaatcacgagtggtgttgatggatataatcaacaaaaatggtttacag
atgctacacaacatgatcaagcagtacagaagggacttcaagaagattccaattcttcgg
aagcttctgaaggtcttggaatatttggcagtgagagagatacttacacggaatcatatt
actgctggtcctccttgtcctgggatggagagctttcggggatcaatattgtcattgaca
gagcatgatgacaaacaggttcatcaaattgcacgtagcttccgagatagatggattcct
aaacctttcagaaaacatagctacaaggacagggatgatagtggaatggatattcacagg
gttgcaaactgcaacaggctcccaatgttgcacaatcatcggcgtgatgaaagtttaaga
ccttcagaagcaattgattgtgtcatgcagtcattggttgcaaaaacttctgtggattct
gctgccaatgaggctggttcttcccctggtgcaggagggtgccagaccaatggccccaaa
gttcgtaaacgtaaaagtcgatgggatcagcctgctgagacaaacctagattcaatcaag
cacaagaaattgatgctcgagtcgagggtgttaccgagtagagaggacatcaattgtcct
gatcatattcacaatcactgtaacaaagatgaagctgttagctccgaagatggaggacag
atcacacaagaggatgttccacctggtttttcatctccgtttaaccctcctctggtttca
tccgattcttcatcaactactgacctgtctcaacaaaatgtttcacagttgagatgtgca
tttgatgtggctattgcacatcctcagggaaaattcaattcccgcctacctgtgtcttat
ggaattccattgcatattttgcagcagtttgggtcatcccaggctgaaactgttgatagt
tgggttatcgctcccagcatgccttttcatccttttccacctttacccccctttccccgt
gataagaaagacactccacctgcctctgctgttagttgtaaaaccattgatggacctgca
gaagaatggcaacaagatagcaatcatggacccagttgctgtccagatgaagacaatcca
agcatgactggagctaaccagtcagatgcagacattccgggcacagacggacaacacacg
tttaaaagaatgaggggatcctctaatgatctgggaaagaggtacttcaggcagcaaaag
aggaagggacccccttggctttggaggagaaatgagcttagaagttcttattgttcacag
gatgttagttgtagggtggataaacctgtcagtagttttattcagcgtccaccacaacaa
aatcatcattga

DBGET integrated database retrieval system