KEGG   Cellvibrio japonicus: CJA_1878Help
Entry
CJA_1878          CDS       T00721                                 

Definition
(GenBank) AMP-binding enzyme domain protein
Organism
cja  Cellvibrio japonicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2173189..2186304)
Genome map
AA seq 4371 aa AA seqDB search
MADSFIMPLTLAHALRAKAEYMPDSTALYFLNDQGDGARQLSYYELDRQARTIAAVIQTM
ASPGDRAILLFPSGVDYVAAFFGCLYAKVIAVPAYPPESVRPQHQARLASIIEDARPRLL
LTDSVLLKPLQEAGQHLLAKLGADAPEWLCVDTLDSVIAERWQKPNIDPGDIAFLQYTSG
STAQPKGVQVSHHNLVTNEWMIRQSFAIGDDDVIVSWLPLYHDMGLIGSLLQSIFSGIPC
VLMSSNYFLERPVRWLEAISHYGGTISGGPDFAYRLCVERIGETALQQLNLSNWKVAFSG
AEPIREDSLRLFSEKFSGCGFNSDKFFPCYGLAEATLFVTGGQRGRAPTLLEVDREALSR
NHAVPGTGATLVGCGRHQPGQEIRIVEPVRQIGLADGVVGEIWTSGPGIANGYWCNAEAT
AKAFVNLDGRIWLRTGDLGFLREGELFITGRLKDMLIVRGHNLYPQDIERTIEEEVEVVR
KGRVAAYAVNFNGEEGIGIAAEISRKLQRLVPAQVLIDSIRQVVAEVFQEVPQQVALLNP
GTLPKTSSGKLQRSACRIGLADGSLDAYALYPAAQQQVIPDNQTTSGSDCGEMIRAIWCD
ILAVEHLAPNAHFFVNGGNSIRAVQMISALRERLGLSLDVWQLFEVPRLDAFSMMVSRQL
AGNTPVINAIPPLASDQTEFACSPGQKRLWFLWQLNPRGAAYNIPGGLHLQGVLNKVALQ
QALQTLVERHEVLRTRFIERDGVPYQSVTGQQNVPVHPIDLTRLPIAEREKRAGQCREEE
ALAPFNLETGPLLRVTLIRLADDEHQLLVTFHHIIVDGWSANILMAELAQLYSAYNQGKT
ITLPMPAVTYGAYAEWQQQWLASEEAQQQRTYWLTQLAGTQALLPLPTRHPGEHINDRHS
EPVLAARLCRKIGPSLAKSLRALADHNDTTLFMVLLAAFHVLLYRYSGEKTIRLGIPSAN
RHQPGIQQVVGFFVNTLVLQGEFEPRLAFTGMLAAVKANTLAAQAHQDLPFDQLSEALGV
AFNVMFNHQQRDPAAACAIPGLAVEELPWHSRHAKCDLQLQSEEDNQGNLCLSWDYAESL
FDADVIVRMAEHFQYLLQQIADDPQRAIADLSLLDAAGYRQLSTWEHVPGLGRSSTLLAG
LEHAAALYPERIAIQWAGESIGYQQLHETANRLAHYLQHCGVGPDVCVGVLIERSPLMLS
AILGILKAGGAYVPLDREYPIARLNDMLRNTGATLLLTSGAAPEGLSRAISIDLATLELA
NWPVTPPVVDLHDHHLAYVIHTSGSTGRPKAVGVSRGAMGERLAWMQATYALTSEDVLLQ
KAPLTFDVSVWECFWPLLAGARLVLPGVGDQRDPYRLLEWVIREHVSVLHFVPSLLQQFI
EQPDAANCHSLRLLFSGGEVLSPALRDRVLDVLPQVTLHNRYGPTEAAINATYWQCQKDD
TEFSPIGRPLSGTCCRVLDGEFAQVPPGVAGELCIGGAGLARGYLGSPAQTAQRFVPDPY
ADDTNAGARLYRSGDGALWHTDGALVFLGRLDRQVKLRGFRIEPGEIEARLCEMAGIRQA
AVQVHTRANGDQQLLAYYTLEKGRGIAPDSLKQALKQVLPDYMVPAQLIPLDEMPLLSSG
KVDYQGLPLPGWQRREYIAPVTPLEQQIAAIWQEVLSLPDIGLADDFFALGGHSLLATQI
VARTRQRCNVTLPLKALFDASELRAFATVVARARQAGEINRQPPIETVDRHQPIPLSYSQ
QRLWFLWHLEPESPAYNVGGMARFNGALDVDALDLALQALIERHETLRTTFPEVDGVPVQ
QVRDRSDVRLARHDLAHLEPADRQARLAALADREAHQPFDLEQGPLLRAHSIRFSDQEHY
LVLTLHHIVTEGWAMDIFARELALLYEAFAAGLPSPLAPLPVQYLDYSVWQRRWLESGER
ERQLDYWREQLGTEHPLLELPADRPRPAVQSHRGELYRFDLPDELAARVHAFNATRGTTL
FMTVTAALALLLYRYSGQDDLRIGVPVANRIRPESEGLIGAFLNTQVLRCQVRAEMKVSE
LLDQVRRTVIEGQSHQDLPFEQVVDALQPQRSAAYNPLFQVMCNVQRWQFQQTRELAGMT
VEYIVNDARAIKFDLNLEVTDLDGRLGCCLTYSRDLFDEPRIAAMADHWRNLLAAMIGDP
QQAVASLPLFNSAEQAQLLACLNPSPVDAVSHSELIPVQDRFAQRAASAPEAIALIMDGE
TLCYGELERRANRLAHWLRAQGIQPEQRVGLALERSFEMVIGLLAILKSGAAYVPLDPEY
PRERLHYIIEDSGIVMLLGYRALFDTMGELPAEVNRWCLEDDSVALAHYPDSAPASLTQP
RHQAYLIYTSGSTGKPKGVVVDHGPLAMHCQAVIDTFGMRDDDCELHFYSINFDAASERL
LTALLCGARVVLRRQGQWAVEEIASLIAEHKVTILGLTPGYGSQLAQWVMDHRAVKENAF
SSVRLCITGGEALTPEHWQAMSRAFQPAYFFNAYGPTETVVMPLAAPVGDSVRQGTATLP
IGKAVGERVAYILDDNLMPVPAGATGELYIGGLGVARGYHGRLDLTAERFIPNPFDIAGR
LYRTGDLVRLNADGLAEYVGRGDNQVKIRGFRIELGEIESCLLGAPGVREAAVLAVGNEG
HRQLVGYLSGQVLADETIDTFKARVKDYLQQQLPDYMVPAQLIVLDRLPLNPNGKLDRRA
LPAPEIAALTQAYTQPESDLERELADIWSKVLNVDSVGIDHNFFELGGDSILSIQVVSRA
RQRGIHFKPKDLFQYQTVRTLARVATLKTQASDGLALTVEQGPLAGPSPMTPIQHWFFTL
NVPHPPHWNQAVWLDMSEPVKPVLLELALQRLIHHHDALRLRFDQQEGQWQAAYQASVDL
NGAAQPLLQVVNVAQVTDASPDVDAVQRSLDLQQGPLLRGLLLQAKNGGQRLLLVIHHLV
VDGVSWRILLEDLQLCYRQLHAGAEIHLPAKTTAFRDWAAYWSDYANSDAIPEALAWWQT
ELDFAGLSNGTQGDAIEVNPTAKKHALPCDFPAGENLEWQANTLTVCLDPDQTQALLQRA
PAAYRTQVNDLLLTALARVLCRWTGDESVLVQLEGHGREYTEDILDLTRTVGWLTAAYPV
RLTPDMGDRVASIKAVKEQLRSVQSRLQSYGPLRYLATGWVREAMAALPVPSLTFNYLGQ
IDQGIDQDGLFRWAGGAETGNRDPEAPLPNDISIDGQVQGGALVLRWTYSAARYRESTIA
ELAEDYIRELDTLIATCLVDTNGGLTPSDFPLAQLSQVQLDALPIPARHIEDIYPLTPMQ
EGLLLHTLLEPGTGIYYMQDRYCIDSAVDPACFASAWQAVVDRHEALRTSFSWNAGEAMV
QIVHKTWPVPMDYQDWRGVSEADNEQRLRALLKTEREAGFDLLNAPPFHLRLIRIDEARY
WFLMSNHHILIDAWCRSLLIGDFFAIYSALLEGRNLALPAAPRYRDYIAWLGSQDPALSR
QWWRTALQGFGASTPIASDRPLLREHAGNNGGMQVGDCYSHLSAQASHQLQTLARQHQLT
INTFAQAAWALVLRRLSGQRDVLFGVTVAGRPIHLPALQQTVGLFINSIPLRVGFPDIGE
DCRVSNWLQHLQAHNLELRDHEHLPLVDIQACSEVPKGEPLFDSLFVFENAPVEVSVLDR
ARQFNASSDSGRTHTNFPLTAVCYPGEELGLHISFDQRYFNDATVEAMLGEFQRLLLALV
QGFDGMLGDIPLVGSSEQDFLIHECNNSERNYPLESYVRLFEQQVSIHAESIVASCRGEQ
WQYRELNQYANRLGHRLLALGNLADKPVALLAERNLKLLGMILGTFKAGTAYLPLDPAHP
LQRLADMLTMSRAPVLVCERSQVALGHDVLALCPEHNRPLLLVWEDTQHDAVPDHNPGIY
GTANSLAYVIYTSGSTGKPKGVMVTQRGMLNNQLSKVPYLQLDERDVVAQTASQCFDISV
WQFLAAPLFGGRVVIVPNDIAHHPTALMAQVVAERITVLESVPSLIQRMLEEDEQPLSGL
RWMLPTGEAMPPLLAKRWLERYPDIGLVNAYGPAECSDDVAFFPVSESFTTGSYLPIGSP
TDNNRLYVLNDELSLTPIGAVGELYVAGTGVGRGYLADPVRTARAFIPNIFGGIGERLYG
TGDLARRRSDGLLEYVGRADHQVKMRGFRIELGEIESCLLDVEGVREAAVIVQARLSGDY
LVAYLTPTQTFIASHSQSELIERCKSWLQACLPDYMVPAYWQLLAEMPRNTNGKLDRKAL
PTLDIGALQEQSYVAPRDTLEQQLAAIWADVLKIDKVGIHDNFFQLGGHSLLATQIASRV
QKVLHKGIPLRAMFECHTVESLADFIRGLESSSITREKADRLSDLMAQLEV
NT seq 13116 nt NT seq  +upstreamnt  +downstreamnt
atggccgactcattcataatgccattaacactggcccatgcattgcgggcgaaagctgag
tacatgccggacagtacggcgctgtactttctgaatgatcagggggatggggctagacag
ctaagctattacgaactggataggcaggcgcgaacaattgcggctgttatacaaaccatg
gccagtccgggtgatagggcaatcctgctgtttcccagtggggttgattatgtggcagca
ttttttggttgcttatatgcaaaagttatagccgtacctgcttatccaccagaatctgtc
agacctcaacaccaggcgcgcctggcatctattatcgaagacgctcgtccccgcttgtta
ttgacggattcggttttgctcaaaccattgcaggaggctggccagcatcttttggcaaag
cttggtgccgatgctccggagtggttgtgtgttgacaccctggacagtgttattgctgag
cgttggcagaaacccaatattgatcccggcgacatcgcttttctgcaatatacctctggc
tctacggcacaacccaaaggggtgcaagtcagtcatcataatttggtaaccaatgaatgg
atgattcgccaaagctttgccattggcgatgatgatgtgattgtcagttggctgccgctt
tatcacgacatgggattgattggctcactactgcaatccattttcagtggtattccctgt
gtgttgatgtcatctaattattttttggagcggccggttcgctggctggaggccattagt
cattacggcggcacgatcagcggcgggcccgactttgcttatcgcctgtgtgtcgagcgt
attggtgagacagcactacaacagctcaatttgagcaattggaaggtggcgttttccggt
gccgaacccattcgtgaagacagcctgcgcttgttcagcgagaagttttcggggtgtggc
ttcaacagcgataaattctttccctgttatggtttggctgaggccaccttgtttgtaaca
ggtgggcaacgtgggcgggcaccgacactcctggaggtggatcgggaggcactatcgcgc
aatcatgccgtccctggaacgggagcgactctggttggctgtggccgacatcaaccagga
caggaaattcgcattgttgaacctgttcgccaaattgggttagccgatggtgttgtcggc
gaaatatggacatccggcccggggattgccaatggttattggtgtaatgccgaggcgaca
gcaaaagcgtttgtcaatctggatggccgcatttggttgcgcaccggggacttgggtttt
ttgcgtgagggtgagttattcatcaccgggcgtctgaaagacatgctgatcgtgcgcggg
cataacctctatccccaggatatcgagcgcacgattgaagaagaagtggaggtcgtacgg
aaagggcgggtagcggcctatgctgtcaattttaatggcgaagaaggtatcgggattgcg
gcagaaatcagtcgtaaattgcagaggctggtgccagcccaggtattgatcgacagcatt
cggcaggtggtggcagaagtatttcaagaggtgccgcagcaagttgcgctgcttaacccc
ggaaccttacccaaaacctccagtggtaaattgcagcgctccgcctgccggattggattg
gcagacggtagtttggacgcttatgcgctttatccagcagcgcaacaacaggtaatccct
gataaccaaaccaccagcggctcggactgtggagaaatgattcgggctatttggtgtgac
atattggctgtggagcatttagcccccaatgcccatttctttgttaatggtggtaattca
attcgcgccgtacaaatgatcagtgcgttacgggagcggttaggtttatccctggatgtt
tggcagttgtttgaagtgcccaggctggatgcgtttagcatgatggtttccaggcagctt
gccgggaatactccggtcattaatgctattccgcccttagcgagtgaccagacggaattt
gcgtgttcaccggggcagaaacgcttgtggtttttgtggcaactgaatccgcgaggtgct
gcctataacattcctggcggcttgcacctgcagggtgtgcttaacaaggtggcgctgcaa
caggcattgcaaaccctggtggagcgtcatgaggtattgcgtacccgatttattgaacgc
gatggcgtgccttatcagtcagtgacaggacaacagaatgtccctgtgcatcctatcgat
ttgacccgacttcccatcgccgagcgggagaagagagcaggccagtgccgggaggaagag
gccctggctcctttcaatcttgaaacaggccccttactgcgagttaccttgataaggttg
gctgatgatgagcaccaattactggtcacctttcaccacattatcgtggatggctggtct
gccaatatcctgatggcggaattggcccagctctacagcgcctataaccagggcaaaacc
atcaccttgcctatgccggctgttacctatggagcctatgctgaatggcagcagcagtgg
ttggcgagtgaagaggcccaacagcagcgcacttattggttaacacagttggccgggaca
caggcgctgctgccgctaccaacccgacatccgggagagcatatcaatgaccgccatagt
gaaccggtattggctgctcgcttgtgtcgaaagatagggccctctttggcgaagagcctg
cgcgccttggctgaccataacgacaccacactttttatggtgttgttagccgcattccac
gtgttgttgtaccgctatagcggtgaaaaaacgatacgccttggtatccccagtgccaat
cgccatcagcccgggattcagcaagtggtgggatttttcgttaacaccctggtattgcaa
ggtgagtttgaaccgcgcctggctttcacaggaatgctggcggcagtaaaagctaacacg
ctggcagcccaggcacatcaagaccttccctttgatcagctgagcgaagcactgggggtc
gctttcaatgtgatgttcaaccaccagcagcgtgacccggcagcggcctgcgccataccg
ggattggcggtggaagagctgccctggcatagccgccacgccaaatgcgatttgcaattg
caatcggaggaagacaaccagggaaatctatgcctgtcctgggattatgcggagtcgttg
tttgatgcggatgtcatcgtgcgtatggcggagcatttccaatacctgctgcagcaaata
gcagatgatccacagcgggccattgctgatttgtcattactggatgctgccgggtatcgc
cagttatccacctgggagcatgtacctggactgggtcgcagcagcacgctgttggcgggc
ctcgaacatgccgctgccctgtaccctgaacgcatcgctatccagtgggcaggcgagagt
atcggttatcagcagttgcatgagactgccaatcgcctggcccattatctgcaacattgt
ggtgtcgggccggatgtctgcgtaggtgtgctgattgagcgttcgccgctgatgttgagc
gcaatcttggggatcttaaaggccgggggagcttatgtgccactggatagggagtatccc
atcgccaggctcaatgacatgttgcgcaataccggtgcgacgctattgcttacttcaggc
gctgctccggagggactcagcagggcgatcagcattgatctggccacactagagttggct
aactggccggtgaccccgccagttgtggatttgcacgaccatcacctggcctatgtcatt
catacctccggttccactggccgtcccaaggccgtgggtgtcagccggggcgcaatgggg
gagcggctggcctggatgcaagccacctatgccttgacgagtgaggatgtcctgctgcaa
aaggcaccgctgaccttcgatgtgtccgtgtgggaatgtttctggccattacttgccggt
gcccgcctggtattgcccggggtaggggaccagcgcgatccataccggttattggagtgg
gttatcagggaacatgtcagcgtattgcattttgtgccatcgctgctgcagcaattcatt
gagcagcccgatgcagcgaattgccactcgttgcgcctgctgttttccggtggagaagta
ttgtcgcccgcactgcgcgaccgtgtgctggatgtattgcctcaggtgacactgcacaac
cgctatggcccaaccgaggccgctatcaacgctacctactggcaatgccaaaaagacgat
acggaattctcaccgattggcaggccgctgtccgggacttgttgccgggtgctggacggc
gagtttgcgcaagtaccccctggtgttgcaggcgagctgtgtattggcggagcagggctt
gcccggggatatctggggagcccggcgcagacagcgcagcgatttgttcccgatccctat
gccgacgacacgaatgcaggggcgcgcttatatcgctctggcgatggagcgctttggcat
accgatggtgccctggtgttcctcgggcgcttggatcgacaagtgaaactgcgcgggttt
cgtattgaaccgggggaaatagaggctcgcttgtgtgagatggcgggtatccggcaggcc
gcggttcaggtacacaccagggccaatggcgaccagcaactgctggcttattacaccctg
gaaaaaggccggggcattgctccagattcgctgaagcaggcactcaaacaagtgttacca
gattatatggttccggcccaattgattccgctggatgagatgccgttattgtccagtggc
aaagtggactaccagggtttgccactgcctggctggcagcgacgtgagtatatcgcgccg
gtcacgccgcttgagcaacagattgcagctatttggcaggaggtcttaagcctgcccgat
attggcctggctgatgatttttttgcgctgggcgggcattcgctattggctacccagatt
gtggcgcgtacccgtcagcgctgtaatgtgacacttccgctcaaggcgctctttgacgcc
agtgaattacgggcttttgcgactgtggtagcacgcgccaggcaggcaggtgagatcaat
cgccagccgccgattgagacggtggatcggcatcaacccatccccttgtcttactcccag
caacgcttatggttcctgtggcatctggagcctgagagtcccgcgtataacgtcggcggt
atggcgcggtttaacggggcgctggatgtggatgccctggatttggctctgcaggcgctc
attgagcgccatgaaaccttgcgtactacctttcctgaagtcgatggcgttccggtacag
caagtgagggacaggtcagacgttaggttggccaggcatgatcttgctcacctggagccc
gctgatcgccaggcgcggttagcggcactggcagaccgggaggcacatcagccttttgac
ctggagcaggggccgctgctgcgcgcccattcgatcaggttcagtgaccaggaacattat
ctggtgctgaccttgcaccatattgtgactgaggggtgggcgatggatatcttcgcccgt
gaactggctctattgtatgaagcatttgccgctggcttgccatcgccattggcgccattg
ccggtgcaatacctggattacagcgtatggcaacggcgctggctggagtccggtgagcgc
gaacgccagcttgattattggcgtgaacaattgggcactgaacacccgctattggagtta
cccgctgaccgcccccgacctgcggtacaaagccaccgcggcgagctttatcgcttcgat
ctgcccgatgagctggccgcccgtgttcacgcgtttaatgcaacccgtggcactacattg
tttatgacggttacggcggctttggcgctgttgctataccgctacagcggtcaggacgat
ctgcgtattggtgtaccggtggccaaccgtattcgccccgagagcgaagggctgatcggc
gcattcctgaacacccaggtgttgcgttgccaggtgcgcgctgagatgaaagtgtcagag
ctgctggaccaggtgcggcgcacagtcatcgaggggcaatcccatcaggatctgcctttt
gaacaagtggtggatgccttgcagccacagcgcagtgccgcctataacccgctgttccag
gttatgtgcaacgtgcagcgttggcagttccagcaaacccgtgaattggcaggtatgact
gttgaatacattgtcaacgatgccagggccattaaatttgacctcaacctggaggtcacc
gatctcgatggccgcttgggatgttgcctaacctatagccgtgatctgtttgatgagccg
cgcattgctgccatggctgatcactggcgcaacctgctcgcggcgatgattggtgatccc
caacaggcagtggcctctctccccttatttaacagcgctgaacaggcgcaactccttgcg
tgcttgaacccatccccggtcgatgccgtcagccatagcgagctaatccctgtgcaggac
aggtttgcccagcgggctgcatccgcgcctgaagcgattgcgttaatcatggatggcgaa
acgctctgttacggcgaactggagcgccgcgccaatcgcctggcccattggctgcgcgcg
caaggaatacaaccggaacagcgggtaggactggctctggagcgctcttttgagatggtg
attgggctgttagccatactcaagtcgggtgcagcttacgtgccgctggatccggaatat
ccccgggagcgactgcactacatcatcgaagacagcggcattgtgatgctactgggctat
cgcgccctgtttgacaccatgggtgaattgccagccgaggtcaatcgctggtgcctggag
gatgacagcgtggccctcgctcattatccggacagcgcacctgccagcctgacccagccc
cggcatcaagcctatttgatctatacctccggctccacgggcaagcccaagggggtggtc
gttgaccatgggccattggccatgcactgccaggcggtaattgataccttcggtatgcgt
gacgacgactgcgagctgcatttttattccatcaatttcgatgcggccagcgagcgctta
ttgactgccctgttatgcggggcccgcgtggtgttgcgccgccagggacaatgggcagta
gaagagattgcctcgctgattgcggaacataaggtcacgattctgggcttgactccaggc
tatggcagccagctggcccaatgggtaatggatcatcgggcggtgaaggaaaatgcgttt
tcatcggtgcgcctgtgtattaccggcggtgaggcactgaccccggaacattggcaagcg
atgagccgggcgtttcagcctgcgtatttttttaacgcatatgggccgacagaaacggtg
gtaatgccgttggcagcccctgtcggtgatagcgtccgccagggaacagcgacactaccc
attggtaaggcggtgggagagcgggttgcctatatcctcgacgataacctgatgccggta
cctgccggtgctaccggtgaactgtatatcgggggactgggtgtcgcccgtggttaccat
ggccggctggacctgactgcagagcgatttattcccaaccctttcgatattgccgggcgt
ttgtatcgaaccggtgatctggtgcgtttgaatgccgatggattggctgaatatgtgggg
cgcggcgataaccaggtcaagattcgcggttttcgcattgagctgggcgaaatcgagtct
tgcctgttgggggctcccggtgtacgggaggcagcggtcctcgctgtgggcaatgagggc
caccgtcaactagtgggttatctcagtggacaagtgctggctgatgaaaccattgacact
ttcaaggcccgtgtgaaggactatctccagcagcagttgccggactatatggtgcccgca
caactgatagtgctggatcggttgccactcaatcccaacggcaaactggatcgccgtgcg
ttacccgcccctgaaatagctgcgctcacccaagcctatacccaaccggaaagtgacctg
gagcgggaactggcagacatttggagtaaggttctgaatgtggacagcgtcggcatagac
cacaatttcttcgagctgggcggcgactcgattttatccatccaggtggttagccgtgcg
cgccagcgaggtatccacttcaagcccaaagacctgttccagtaccagacggtgcgcacc
ctggccagggtagccacgctaaaaacccaggcatcggacgggttggcgctcaccgtcgaa
caggggccactggcaggcccgtcaccgatgacacctatccagcattggttctttaccctg
aatgtgccgcatccaccgcattggaaccaggcggtttggctggacatgagtgagcctgtt
aaacctgtactgctggaactggcgttacagcgattaatacatcatcacgatgccctgcgc
ttgcgttttgaccaacaggaggggcaatggcaggcggcataccaggcatcggtcgatctc
aatggcgcagcacagccgttattacaggtggtaaatgtcgcgcaggtgacagacgcttcg
ccggatgtggatgctgtgcagcgcagcctggatttgcaacaggggccgttattgcgcggc
ttgttactccaggcgaagaacggcggccagcgcttattgctggtgattcaccacctggtt
gtggatggcgtgtcatggcgcatcctgctggaagatttgcagttgtgttaccggcaatta
cacgccggtgcagagatccatctgccagccaaaaccacagcctttcgggattgggcagcc
tactggagcgattatgccaacagcgatgcaatacctgaggcactggcgtggtggcaaaca
gaattagacttcgccggattgtccaatggcacccagggcgacgctatagaggttaacccg
accgcgaaaaaacacgcattgccctgtgattttcccgctggtgaaaacctcgaatggcag
gccaatacgctaaccgtctgcctggatcccgatcagacacaagcgctgttacagcgggcg
cctgctgcgtatcgaacccaggtgaatgatttgttattaacggcattggcacgcgtattg
tgccgttggaccggggatgaatcagtgttggtgcaattggaggggcatggtcgggagtac
acagaggacatcctggatctgacccggacggtaggctggttaaccgctgcttacccggtt
cgcttaacgccggacatgggcgatagggttgcatccatcaaggcggttaaggaacagctc
agatcggtgcagtcacgtttgcaaagctatggcccgctgcgctacctggcaaccggttgg
gtgcgcgaagcaatggctgcactgccggttccgtccctgacatttaattatttgggacag
attgaccagggcatcgaccaggatgggcttttccgctgggctggtggcgcggaaaccggt
aatcgcgatcccgaggcccccttgcccaacgatatcagtatcgatggccaggtgcagggc
ggggccctggtattgcgctggacatacagtgcggcgcgctatcgcgaaagtacgatagcc
gaactggcggaagactatatccgtgagctcgatacccttattgctacctgtttggtggat
acaaacggagggctgacgccatccgacttccccctggcacagctctcccaggtgcaattg
gatgcattgccaatacccgcgcggcacatcgaggatatttatcccttaactcccatgcag
gaaggtttgctgctgcacaccctgttggagccgggcaccggtatttattacatgcaggat
cgctactgtattgacagtgcggttgaccctgcctgtttcgcgagtgcctggcaagcggtg
gtggatcgccacgaagccttgcgcacgtcattcagctggaatgccggtgaagccatggtg
caaatcgtccataaaacctggccggtgccaatggattatcaggattggcggggcgtttca
gaggctgataatgagcagcggttgcgcgctttattgaaaaccgagcgggaggcgggcttt
gatttgctcaatgcaccaccgttccatttgcgcctgatccgtatcgatgaggcgcgctat
tggtttttgatgagtaaccatcacatcctgatcgatgcctggtgtcgttcgttgctgatc
ggggatttctttgccatctatagcgcactgcttgaaggtcgcaacctggcgttgccggca
gcaccgcgctatcgcgactatatcgcctggctgggtagccaggatcctgcgctcagccgc
caatggtggcgcaccgcattgcaggggttcggtgcatctacgcctattgccagcgatagg
ccgctgttgcgggaacacgccggcaataacggcggaatgcaagtgggcgattgttacagt
catctcagcgcgcaggccagccaccaattgcaaaccctggcgcgacagcaccagctgacc
atcaacacttttgcccaggcagcctgggccctggttctgcgtcggctcagcggccagcgc
gacgtattattcggggttaccgtcgcagggcgacccatccatttaccggcgttacagcaa
acggtggggttgtttatcaacagtattccgttgcgggttggctttcccgacatcggtgaa
gactgccgggtaagtaattggctgcaacacttgcaagcacataacctggagctgcgcgat
cacgaacacctgccgctggtcgatattcaggcttgcagtgaggtacccaaaggggagccg
ctgtttgacagtctattcgtattcgaaaatgcccccgtggaagtgtcggtgctggatagg
gcgcggcaattcaatgccagttccgactccgggcgtacccacaccaattttccgttgacc
gcagtttgctatccgggcgaggaattgggtttacatatctcctttgaccaacgttatttt
aacgacgctaccgtggaggccatgctaggggaattccagcgcttgctgttggcactggta
cagggctttgatggcatgctcggtgatataccgctggtcggttcaagtgagcaggatttc
ctgatccacgagtgcaataacagtgagcgtaactacccgctggagagctatgtccgttta
tttgagcagcaggtttccattcacgccgaaagcatcgtggccagttgccgtggtgagcaa
tggcaataccgggaacttaaccagtatgccaatcgcctgggacatcgtcttttggcactt
ggcaatctggctgacaaaccggtggcgctgcttgccgaacgcaatctgaagttactgggc
atgatactgggcacctttaaagcagggacggcctatctccccctggaccccgcgcatccg
cttcaacggcttgccgacatgttgaccatgagccgcgctcccgtactggtgtgcgagagg
agccaggttgcactcggccatgatgtactcgccctctgtccagagcacaatcgtccattg
ctgctggtatgggaggacacacaacacgatgctgtgcccgaccataatccggggatatac
ggtactgcaaacagtctcgcctatgtgatctatacctctggctctacggggaaacccaaa
ggggtaatggttacccagcgcggtatgctcaataaccaattgagtaaagtgccgtatctg
cagttggatgagcgcgatgtcgttgcccagacggcgtcccaatgctttgacatttcggtg
tggcagtttttagcggctccgctgtttggcggccgggttgtcattgtccccaatgatatt
gcacaccatccaacggccctgatggcacaggttgttgcagaacgtattactgtcctggaa
agtgtgccctcgttgatccaacgcatgttggaagaagatgaacaaccgctatcgggtttg
cgctggatgttgcccaccggggaagccatgccaccgcttctggcaaaacgatggctggaa
cgctatccggatattggcctggtgaatgcttacgggccggcagaatgctcggacgatgtg
gcattcttcccggtgagtgagtcgtttacaacaggtagttatctgccgatcggctcaccc
acggacaacaatcgcctttacgtactgaatgacgaactttcactcacgcctattggcgcc
gtgggtgaattatatgtggcagggacaggggtagggcggggttacctcgctgatccggtg
cgcactgcgcgcgcttttattcccaatatatttggaggcattggcgagcggctgtacggc
acaggcgatctcgcacggcgtcgttcagatggtttattggaatacgtcgggcgagcagac
catcaagtcaagatgcgtggctttcgtattgaactgggggaaattgaatcctgcctgctg
gatgttgaaggcgtgcgcgaggctgcggtgattgtccaggcgcgcttgagtggggattat
ctggtggcttatttgacaccaacccaaaccttcatcgcctcccactcacaatctgaattg
atcgagcggtgcaagtcgtggctgcaggcttgcctgcctgattatatggtacctgcctat
tggcaactgcttgcagaaatgccgcgcaacaccaacggcaaactggatcgcaaggcgcta
cccactttggatattggtgctttgcaggaacagagttatgtcgcgccacgggatacctta
gagcagcaattggcagccatttgggccgatgtgttgaaaattgacaaggttggtatacac
gacaacttttttcaattgggcggacactccctgcttgccacccagattgcctcacgggta
caaaaggtcttgcacaaaggtattcccctgcgcgcgatgttcgagtgccataccgttgaa
tcattggcagactttatccgggggcttgagagctcatccattacccgggaaaaagccgat
cgcttaagtgatttaatggcgcaacttgaagtgtaa

DBGET integrated database retrieval system