KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394758Help
Entry
100394758         CDS       T03264                                 

Gene name
EZH2
Definition
(RefSeq) enhancer of zeste 2 polycomb repressive complex 2 subunit
  KO
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
Lysine degradation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100394758 (EZH2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100394758 (EZH2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100394758 (EZH2)
Chromosome [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100394758 (EZH2)
   Polycomb group proteins
    PRC2-EZH2 complex
     100394758 (EZH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
8
AA seq 746 aa AA seqDB search
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEW
KQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPEDREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFH
ATPNTYKRKNTEAALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPN
NSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPA
PAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQ
NFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGE
ELFFDYRYSQADALKYVGIEREMEIP
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggccagactgggaagaaatctgagaagggaccagtttgttggcggaagcgtgtaaaa
tcagagtacatgcgactgagacagctcaagaggttcagacgagctgatgaagtaaagagt
atgtttagttccaatcgtcagaaaattttggaaagaacggaaatcttaaaccaagaatgg
aaacagcgaaggatacagcctgtgcacatcctgacttctgtgagctcattgcgcgggact
agggagtgttcggtgaccagtgacttggattttccaacacaagtcatcccattaaagact
ctgaatgcagttgcttcagtacccataatgtattcttggtctcccctacagcagaatttt
atggtggaagatgaaactgttttacataacattccttatatgggagatgaagtgttagac
caggatggtactttcattgaagaactaataaaaaattatgatggaaaagtacatggggat
agagaatgtgggtttataaatgatgaaatttttgtggagttggtgaatgcccttggtcaa
tataatgatgatgatgatgatgatgatggagatgatcctgaagatagagaagaaaagcag
aaagatctggaagatcaccgagatgataaagaaagtcgcccacctcgaaaatttccttcc
gataaaatttttgaagccatttcctcaatgtttccagataagggcacagcagaagaacta
aaggaaaaatataaagaactcaccgaacagcagctcccaggcgcgcttcctcctgaatgt
acccccaacatagatggaccaaatgctaaatctgttcagagagagcaaagcttacactcc
tttcatacgcttttctgtaggcgatgttttaaatatgactgcttcctacatccttttcat
gcaacacccaacacttacaagcggaagaacacagaagcagctctagacaacaaaccttgt
ggaccacagtgttaccagcatttggagggagcaaaagagtttgctgctgctctcactgct
gagcggataaagaccccaccaaaacgcccaggaggccgcagaagaggacggcttcccaat
aacagtagcaggcccagcacccccaccattaatgtgctggaatcaaaggatacggacagt
gatagggaagcagggactgaaacagggggtgagaacaatgataaagaagaagaagagaag
aaagatgaaacttcgagctcctctgaagcaaattctcggtgtcaaacaccaataaagatg
aagccaaatattgagcctcctgagaatgtggagtggagtggtgctgaagcctcaatgttt
agagtcctcattggcacttactatgacaatttctgtgccattgctaggttaattgggacc
aaaacatgtagacaggtgtatgagtttagagtcaaagaatctagcatcatagctccagct
cccgctgaggatgtggacactcctccaaggaaaaagaagaggaaacacaggttgtgggct
gcacactgcagaaaaatacagctgaaaaaggacggctcctctaaccatgtttacaactat
caaccctgtgatcatccacggcagccttgtgacagttcgtgcccttgtgtgatagcacaa
aatttttgtgaaaagttttgtcaatgtagttcagagtgtcaaaaccgctttccgggatgc
cgctgcaaagcacagtgcaacaccaagcagtgcccatgctatctggctgtccgagagtgc
gaccctgacctctgtcttacttgtggagctgctgaccattgggacagtaaaaatgtgtct
tgtaagaactgcagtattcagcggggctccaaaaagcatttattgcttgcaccatctgat
gtggcaggctggggaatttttatcaaagatcctgtgcagaaaaatgaattcatctcagaa
tactgtggagagattatttctcaagatgaagctgacagaagagggaaagtgtatgataaa
tacatgtgcagctttctgttcaacttgaacaatgattttgtggtggatgcaacccgcaag
ggtaacaaaattcgttttgcaaatcattcggtaaatccaaactgctatgcaaaagttatg
atggttaacggcgatcacaggataggtatttttgccaagagagccatccagactggtgaa
gagctgttttttgattacagatacagtcaggctgatgccctgaagtatgttggcatcgaa
agagaaatggaaatcccttga

DBGET integrated database retrieval system