KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394788Help
Entry
100394788         CDS       T03264                                 

Gene name
SETDB2
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100394788 (SETDB2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100394788 (SETDB2)
Chromosome [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100394788 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100394788 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 707 aa AA seqDB search
MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKQKIKNGSATNKEYIQAMILVNEAT
ISNSSTSVKDLMPVTQNEQENKSNAFPSTSYENSFPEDSPFLSTENKEIISLEDKVVDFR
EKDSFLNLSYQSHDCSGACLMKMPLTLKKENPLQLPIKCHFQRRHAKTNSHSSALHVSYK
TPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLARNYPKQEEVVSNVDISNGVES
VPISFCNEIDSRKPPQFKYRKTVWPRAYYLTNFASMFTDSCDCSEGCIDITKCACLQLTA
RNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCKCNRQLCQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDRGTFVCIYSGRLLNRANTEKSNGVDENRRDENTMKNVFSKKRKL
EVACSDCEVEVIPLGLETHPKSAKTEKYSPKFSNNPKEFTMEMKYSNISRIQYHSVIRGP
ESKTAMFQHNGKKMEFVSSESVTPEDHDGFKPTQEHLNSETKGAQKNSSSNHVDDFEDNL
LIESDVIDITKCREETPPGSRCNQATTLDNQNIKKAIEVQIQKPQEEQSTTCQKQQVFCD
EELLSETENTSSDSLTKFSKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHDRNF
PLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaaaactttctggatggagctagaagatgatggaaaa
gtggacttcatatttgaacaagtacagaatgtgttgcagtcactgaaacaaaagatcaaa
aatgggtctgccaccaataaagaatatatccaagcaatgattttggtgaatgaagcaact
ataagtaacagttcaacatcagtaaaggatcttatgcctgtgactcagaatgaacaggaa
aacaaatccaatgcatttccctccacatcatatgaaaactcctttccagaagactctcca
tttctatcaacagaaaataaggaaattatctctctggaagataaagttgtagacttcaga
gaaaaagactcatttttgaatttatcttaccaaagtcatgactgctctggtgcttgtctg
atgaaaatgccactcaccttgaagaaagaaaatcctctgcagctgccaatcaaatgtcac
ttccaaagacgacatgcaaagacaaactctcattcttcggcactccatgtgagttataaa
accccttgtggaagaagtctacgaaacgtggaggaagtttttcgttacctgcttgagaca
gagtgtaactttttatttacagataacttttctttcaatacctatgttcagttggctcgg
aattacccaaagcaagaagaagttgtttctaatgtggatattagcaatggagtggaatca
gtgcccatttctttctgtaatgaaattgacagtagaaagcccccacagtttaagtacaga
aagactgtgtggcctcgagcatattatctaaccaactttgccagcatgtttactgattcc
tgtgactgctctgagggctgcatagacataacaaaatgtgcatgtcttcaactgacagca
aggaatgccaaaacttcccccttgtcaagtgataaaataaccactggatataaatataaa
agactacagagacaaatacctactggcatttatgaatgcagcctgttgtgcaaatgtaat
cgacaattatgtcaaaaccgagtcgtccaacatggtcctcaagtgaggctacaggtgttc
aaaactgagaagaaaggatggggggtacgctgcctagatgacattgacagagggacattt
gtttgtatttattcaggaagattactaaacagagctaacactgagaaatctaatggtgtc
gatgaaaacaggagagatgagaatactatgaaaaatgttttttcaaaaaagaggaaatta
gaagttgcatgttcggattgtgaagttgaagttatcccattaggattggaaacacatcct
aaaagtgctaaaactgagaaatattcgccaaagttcagtaataatcccaaggagtttact
atggaaatgaagtatagcaatatttcaagaattcaatatcattcagttattagaggtcct
gaatccaagacagccatgtttcaacacaatgggaagaaaatggaatttgtttcctcagag
tctgtcactccggaagatcatgatggatttaaaccaacccaagaacatctgaactctgaa
accaagggagcacaaaagaactcaagttcaaaccatgttgatgactttgaagataatctg
ctgattgaatcagatgtgatagatataactaaatgtagagaagaaactccaccagggagc
agatgtaaccaggcaaccacattggataatcagaatattaaaaaggcaattgaggttcaa
atacagaagccccaagaggaacagtctacaacatgtcaaaaacagcaggtcttttgtgat
gaagaattgctgagtgaaaccgagaatacttcatctgattctctaacaaagttcagtaaa
gggaatgtgtttttattggatgccacaaaagaaggaaatgttggccgcttccttaatcat
agttgttgcccaaatctcttggtacagaatgtttttgtagaaacccacgacaggaatttt
ccattggtggcattcttcaccaacaggtatgtgaaagcaaggacagagctaacatgggat
tatggttatgaagctgggactgtgcctgaaaaggaaatcttctgccaatgtggggttaat
aaatgtagaaaaaaaatattataa

DBGET integrated database retrieval system