KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402023Help
Entry
100402023         CDS       T03264                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc05034  Alcoholism
cjc05165  Human papillomavirus infection
cjc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100402023 (HDAC7)
  Substance dependence
   05034 Alcoholism
    100402023 (HDAC7)
  Infectious diseases
   05165 Human papillomavirus infection
    100402023 (HDAC7)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100402023 (HDAC7)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100402023 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100402023
NCBI-ProteinID: XP_017831271
Ensembl: ENSCJAG00000014979
LinkDB All DBs
Position
9
AA seq 987 aa AA seqDB search
MHSPSADGTQVSPGAHCRSPTGTGCPRPCADTPGPQSQPMDLRVGQRPPVEPPPEPTLLA
LQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVA
SSVVKQKLAEVILKKQQAALERTVHPSSPSIAYRTLEPLETERATRSMLSTFLPPVSSLP
SDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPTETLGDSSPSS
SSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSLAPFALPTVSLLPAITLGLPAP
ARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGGTLPSRLQPILLLDPSGSHAPL
LTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEPLPPSATAPPPPGPMPHLEQLK
THMQVIKRSAKPSEKPRLRQIPSAEDLETDGGTPGQGVDDGLEHRELSHGQPEARGPASL
QQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGVHRPLSRAQSSPAAPASLSTSEPPSQ
ARVLSSSETPARTLPFTTGLVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLRS
QCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVG
VDTDTIWNELHSSNAARWATGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFF
NSVAIACRQLQQQNKASKILIVDWDVHHGNGTQQTFYQDSSVLYISLHRHDNGNFFPGSG
AVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGFDA
AEGHPAPLGGYHVSAKCFGYMTQQLMSLAGGAVVLALEGGHDLTAICDASEACVAALLGN
KVDPLSEEGWKQKPNLNAICSLEAVIRVHSKYWGCMQRLASCPDSWVPRPPGADKEEVEA
VTALASLSVGILAEDRPSEQLVEEKNL
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccccagcgccgatgggacccaggtgagcccgggtgcccactgtcgcagcccc
actggcacaggctgccccaggccctgtgcagacacaccaggccctcagtcccagcccatg
gacctgcgggtgggccagcggcccccagtggagcccccaccagagcccacattgctggcg
ctgcagcgtccccagcgcctgcaccaccacctcttcctagcaggcctgcagcagcagcgc
tcggtggagcccatgaggctctccatggacacgcccatgcccgagttgcaggtgggaccc
caggaacaagagctgcggcagcttctccacaaggacaagagcaagcgaagtgctgtagcc
agcagcgtggtcaagcagaagctggcagaggtgattctgaaaaagcaacaggcagctctc
gagagaacagtccatcccagcagccccagcatcgcctacagaaccctggagcccctggag
acagaaagagccacccgctccatgctcagcacctttttgcctcctgtttccagcctgccc
agtgaccccccagagcacttccccctgcgcaagacagtctctgagcccaacctgaagctg
cgctataagcccaagaaatccctggagcggaggaagaatccactgcttcggaaggagagt
gctccccccagcctccggcgacgacctacagagaccctcggagactcctccccaagtagt
agcagcacgcccgcgtcagggtgcagctcccccaatgacagcgagcacggccccaacccc
atcctgggctcggaggcgctcttgggccagcggctgcggctgcaggagacttctctggcc
ccgttcgccttgccgacagtgtccttgctgcccgctatcacgctggggctgcccgcccct
gccagggctgatagtgaccgcaggacccatccgactctgggccctcgggggccgatcctg
gggagccctcacactcccctcttcctgccccatggcctggagcccgaggctgggggtacc
ttgccctctcgcctacagcctattctccttctggacccctcaggctctcatgccccgctg
ctgactgtgcctgggcttgggcccctgcccttccactttgcccagtccttaatgaccacc
gagaggctctccgggtcaggcctccactggccactgagccggactcgctcagagcccctg
ccccccagtgccaccgctcccccaccgccgggccccatgccccacctggagcagctcaaa
actcacatgcaggtgatcaagaggtcagccaagccgagtgagaagccccggctgcggcag
ataccctcggctgaagacctggagacagatggcgggacacccggccagggggtggatgat
ggcctggagcacagggagctgagccatggacagcccgaggccagaggccctgcatctctt
cagcagcacccccaggtattgctctgggaacagcagcgactggctgggcggctcccccgg
ggcagcaccggggatactgtgctgcttcccctggcccagggagtgcaccggcccctgtcc
cgggctcagtcttccccagccgcacctgcctcactgtcaacctcggagccccccagccag
gcccgagtcctctccagctcagagacccctgccaggaccctgcctttcaccacagggctg
gtttatgactcggtcatgctgaagcaccagtgctcctgcggagacaacagcaggcacccg
gagcacgccggccgcattcagagcatctggtcccggctgcaggagcgggggctccggagc
cagtgtgagtgtctccgaggccggaaggcctccctggaagagctgcagtcggtccactct
gagcggcacgtgctcctctatggcaccaacccgctcagccgcctgaaactggacaacggg
aagctggcagggctcctggcacagaggatgtttgtgatgctgccctgtggtggggttggg
gtggacactgacaccatctggaatgagctgcattcctccaatgcagcccgctgggccact
ggcagtgtcaccgacctcgccttcaaagtggcttcccgtgagctgaagaatggtttcgct
gtggttcggcccccaggacaccatgcagatcattcaacagccatgggcttctgcttcttc
aactcagtggccatcgcctgccggcagctgcagcagcagaacaaggccagcaagatcctc
attgtagactgggacgtgcaccacggcaacggcacccagcagaccttctaccaagactcc
agtgtgctctacatctccctgcatcgccatgacaacggcaacttcttcccggggagtggg
gcagtggatgaggtaggggctggcagtggtgagggcttcaatgtcaatgtggcctgggct
ggaggcctggacccccccatgggggatccggagtacctggctgctttcaggatagtcgtg
atgcccatcgcccgagagttctctccagacctggtcctggtgtctgctgggtttgatgct
gctgagggccacccggccccgctgggtggctatcatgtttctgccaaatgttttgggtac
atgacacagcagctgatgagcctggcaggaggcgcagtggtgctggccttggagggtggc
catgacctcacagccatctgtgatgcctctgaggcctgtgtggctgctcttctgggcaac
aaggtggatcccctttcagaagaaggctggaaacagaaacccaacctcaacgccatctgc
tctctggaggccgtgatccgggtgcacagtaaatactggggatgcatgcagcgcctggct
tcttgtccagactcctgggtgcctcggccgccaggagctgacaaagaagaagtggaggca
gtgaccgcactggcatccctctctgtgggcatcctggctgaagacaggccctcggagcag
ctggtggaggagaagaacctatga

DBGET integrated database retrieval system