KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402142Help
Entry
100402142         CDS       T03264                                 

Gene name
CSAD
Definition
(RefSeq) cysteine sulfinic acid decarboxylase
  KO
K01594  
sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
Taurine and hypotaurine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjc00001]
 Metabolism
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    100402142 (CSAD)
Enzymes [BR:cjc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     100402142 (CSAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
9
AA seq 493 aa AA seqDB search
MADSEALSSHAGDPVAVEALLQAVFGIVVGEAIQKGTSASEKVCEWKEPEELKKLLDLEL
RSQGESQEQILDRCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEI
APVFVLMEEEVLRKLRALVGWSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLP
PLALFTSKECHYSIQKGAAFLGLGTDSVRVVKADERGRMVPEDLERQISMAEAEGAVPFL
VSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQRADSVA
WNPHKLLAAGLQCSALLLQDTSNLLKRCHGAQASYLFQQDKFYDVELDTGDKVVQCGRRV
DCLKLWLMWKAQGSQGLELRIDQAFALARYLVEEMKKREGFELVMEPEFVNVCFWFVPPS
LRGKQDSPDYHKRLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANPALTCADID
FLLNELERLGQDL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggctgactcagaagcactctcctcccatgctggggatcctgtggctgtggaagccttg
ctccaggcggtgtttgggattgttgtgggtgaggccattcagaaaggaaccagtgcctct
gagaaggtctgtgagtggaaggagcctgaggagctgaagaagctgctggatttggagctg
cggagccagggggagtcgcaggagcagatcctggaccgttgccgggctgtgattcgctac
agtgtcaagaccggtcaccctcggttcttcaaccagctcttctcagggttggatccccat
gctctggccgggcgcattatcaccgagagcctcaacaccagccagtacacgtatgaaatc
gcccccgtgtttgtgctcatggaagaggaggtgctgaggaagctgcgggccctggtgggc
tggagctctggggatggaatcttctgccctggtggctccatctccaacatgtatgctgta
aatctggcccgttatcagcgctacccggattgcaagcagaggggcctccgcacactgccg
cccctggccctattcacatcaaaggagtgtcactactccatccagaagggagctgcgttt
ctgggacttggcactgacagtgtccgagtggtcaaggctgatgagagagggagaatggtc
cccgaggatctggagaggcagatcagtatggccgaggctgagggtgctgtgccgttcctg
gtcagtgccacctctggtaccactgtgctaggggcctttgaccccctggaggcaattgct
gatgtgtgccagcgtcatgggctatggctgcatgtggatgctgcctggggtgggagcgtc
ctgctgtcacagacacacaggcatctcctggatgggatccagagggctgactctgtggcc
tggaatccccacaagctcctcgcagcaggcctgcaatgctctgcacttctcctccaggac
acctcgaacctgctcaagcgctgccatggggcccaggccagctaccttttccagcaggac
aagttctacgatgtggaactggacaccggagacaaggtggtgcagtgtggccgccgcgtg
gactgtctgaagctatggctcatgtggaaggcacagggcagtcaagggctggagctgcgc
atcgaccaggcctttgcccttgcccggtacctggtggaggaaatgaagaagcgggaaggg
tttgagctagtcatggagcctgagtttgtcaatgtgtgtttctggttcgtgccccccagc
cttcgagggaagcaggatagtccagattaccacaaaaggctgtcgaaggtggcccctgtg
ctcaaggaacgcatggtgaaggagggctccatgatgattggctaccagccccacggcacc
cggggcaacttcttccgtgtggttgtggccaaccctgcgctgacctgtgctgatatagac
ttcctcctcaacgagctggagcggctcggccaggacctgtga

DBGET integrated database retrieval system