KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410189Help
Entry
100410189         CDS       T03264                                 

Gene name
PCSK2
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 2
  KO
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     100410189 (PCSK2)
Peptidases [BR:cjc01002]
 Serine Peptidases
  Family S8: subtilisin family
   100410189 (PCSK2)
Chaperones and folding catalysts [BR:cjc03110]
 Intramolecular chaperones
  Subtilisin family
   100410189 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
5
AA seq 638 aa AA seqDB search
MKGGCVSQWKAAAGFLFCVMVFASAELPVFTNHFLVELHKGGEEEARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKKRLSLHHKQQLERDPRVKVALQQEGFDRKKRGYRDLNAIDMN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSAQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSTPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSIFGKN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtggttgtgtctcccagtggaaggcggctgccgggttcctcttctgtgtcatg
gtttttgcatctgctgagctaccggtcttcacgaatcattttcttgtggagttgcataaa
gggggagaggaggaagctcgccaagttgcagcagaacacggctttggagtccgaaagctt
ccctttgctgaaggcctgtaccacttttatcacaatggccttgcaaaggccaagaaaaga
ctcagcctacaccacaagcagcaactggagagagaccccagggtaaaggtggctttgcag
caggaaggatttgaccgaaaaaagagaggctacagagatctcaatgcgattgacatgaac
atgaacgatcctctttttacgaagcagtggtatctgatcaatactgggcaagcagatggc
actcctggccttgatttgaatgtggctgaagcctgggagctgggatacacagggaagggt
gttaccattggaattatggatgatggaattgactatcttcacccagacctggcctccaac
tataatgccgaagcaagttacgacttcagcagcaatgatccctatccttaccctcgatac
acagacgactggtttaacagccatgggacccgatgcgcaggagaagtttctgctgccgcc
aacaacaatatctgtggggtcggagtagcgtacaactccaaggtcgcaggcatccgcatg
ctggaccagcctttcatgacggacatcatcgaggcctcctccatcagccatatgccacag
ctgatcgacatatacagtgccagctggggccccacagacaacggcaagacagtggatggg
ccgagggagctcacactgcaggccatggccgatggcgtgaacaagggccgcggcggcaaa
ggcagcatctatgtgtgggcctctggggacggcggcagctacgatgactgcaactgtgac
ggctacgcctccagcatgtggaccatctccatcaactcagccatcaacgatggcaggact
gccctgtacgatgagagctgctcttccaccctggcttccaccttcagcaatgggaggaaa
aggaaccctgaggctggtgtggcaaccacagatttgtacggaaactgcactctgaggcat
tctgggacatctgcagctgcccccgaggcagctggcgtgtttgcactggctctagaggct
aacctgggtctgacctggcgggacatgcagcatctgactgtgctcacctccaagcggaac
cagcttcacgacgaggtccaccagtggcggcgcaacggggtcggcctggaatttaatcac
ctctttggctacggggtccttgacgcaggtgccatggtgaaaatggctaaagactggaaa
actgtgcccgagagattccactgtgtgggaggctccgcgcaggaccctgagaaaatacca
tccactggcaagttggtgctgacactcacaaccgacgcctgtgaggggaaggaaaatttt
gtccgctacctggagcatgtccaggctgtcatcacagtcaacgcaaccaggagaggagac
ctgaacatcaacatgacctcccctatgggcaccaagtccattttgctgagccggcgtcca
agggatgacgactccaaggtgggctttgacaagtggcctttcatgaccacccacacatgg
ggggaagacgcccgaggcacctggaccctggagctggggtttgtcggcagcaccccacag
aagggggtgctgaaggagtggaccctgatgctgcacggcactcagagcgccccgtacatc
gaccaggtggtgcgggattaccagtccaagctggccatgtcaaagaaagaggagctggag
gaagagctggacgaagctgtggagagaagcctgaaaagcatctttggcaagaactag

DBGET integrated database retrieval system